DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nudC and nudcd2

DIOPT Version :9

Sequence 1:NP_001246805.1 Gene:nudC / 39879 FlyBaseID:FBgn0021768 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001016379.1 Gene:nudcd2 / 549133 XenbaseID:XB-GENE-1003676 Length:157 Species:Xenopus tropicalis


Alignment Length:165 Identity:44/165 - (26%)
Similarity:77/165 - (46%) Gaps:50/165 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 GCTLENYTWTQTLEEV--ELKIPFNLTFGLRARDLVISIGKKSLKVGIKGQTPIIDGELCGEVKT 229
            ||      |.||:|||  |:|:|    .|..|:::...:|.:.:.:.:||: .|:.|:|.....:
 Frog    19 GC------WYQTMEEVFIEVKVP----DGTLAKEVQCKLGSRDISLVVKGK-DILKGKLFDSTIS 72

  Fly   230 EESVWVLQDSKTVMITLDKINK--MNWWSRLVTTDPEISTRKINPESSKLSDLDGETRSMVEKMM 292
            :|:.|.|:|.|.:.|.|.|.|:  .|.|:.|                     |:|:..:  :..:
 Frog    73 DEATWTLEDRKLIRIILTKTNRDAGNCWTSL---------------------LEGDYSA--DPWI 114

  Fly   293 YDQRQKELGLPTSEDRKKQDILEKFKQQHPEMDFS 327
            .|:.||:|            .||:|::::|..|||
 Frog   115 QDEMQKKL------------TLERFQRENPGFDFS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nudCNP_001246805.1 Nudc_N 7..58 CDD:290757
p23_mNUDC_like 173..259 CDD:107241 28/89 (31%)
nudcd2NP_001016379.1 p23_NUDCD2_like 12..104 CDD:107243 31/116 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.