DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nudC and NUDCD3

DIOPT Version :9

Sequence 1:NP_001246805.1 Gene:nudC / 39879 FlyBaseID:FBgn0021768 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_056147.2 Gene:NUDCD3 / 23386 HGNCID:22208 Length:361 Species:Homo sapiens


Alignment Length:379 Identity:96/379 - (25%)
Similarity:172/379 - (45%) Gaps:78/379 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAEEGKFDNILLAVAEKHHGGVPEFLGTLASFLRRKTDFF-------------TGAKQTEWEKLL 53
            |||  .:|..||.:.: |.|.|.:||..|..||.|||||:             .||.|.    |:
Human     5 AAE--LYDQALLGILQ-HVGNVQDFLRVLFGFLYRKTDFYRLLRHPSDRMGFPPGAAQA----LV 62

  Fly    54 LDVFNKESKLAVTEN-------YEKIKAREASQ-----RLKAEKERAERKARKQEIDDNKICDIT 106
            |.||.....:|..::       .|||:.:|..:     ...||||......::.|||.....|  
Human    63 LQVFKTFDHMARQDDEKRRQELEEKIRRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELD-- 125

  Fly   107 DEEAAAIIKEEETKKRQ---QLLDSAGGEPSASNRDGISKPIE---------KVDDESDKSELGK 159
                    ..:|.:|.|   .:.:.|.|...|.....::...|         ::.::..|:    
Human   126 --------GHQEVEKVQPPGPVKEMAHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKN---- 178

  Fly   160 LMPNAGNGCTLENYTWTQTLEEVELKIPFNLTFGLRARDLVISIGKKSLKVGI---KGQTPIIDG 221
              |::.||...|||||:|...::|:::|.. ...::.:.:.:::...|::|.:   .|:..:::|
Human   179 --PDSYNGAVRENYTWSQDYTDLEVRVPVP-KHVVKGKQVSVALSSSSIRVAMLEENGERVLMEG 240

  Fly   222 ELCGEVKTEESVWVLQDSKTVMITLDKINKMNWWSRLVTTDPEISTRKINPESSKLSDLDGETRS 286
            :|..::.||.|:|.|:..|.|::.|.|:.:. ||:.::..:..|...|||.|.| ::.:|.|.::
Human   241 KLTHKINTESSLWSLEPGKCVLVNLSKVGEY-WWNAILEGEEPIDIDKINKERS-MATVDEEEQA 303

  Fly   287 MVEKMMYDQRQKELGLPTSEDRKKQDILEK--------FKQQHPEMDFSKCKFN 332
            :::::.:|..||..|.|.|.:.|..::|:|        |:.|.    |....||
Human   304 VLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAEGSPFRGQR----FDPAMFN 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nudCNP_001246805.1 Nudc_N 7..58 CDD:290757 22/63 (35%)
p23_mNUDC_like 173..259 CDD:107241 22/88 (25%)
NUDCD3NP_056147.2 Nudc_N 9..67 CDD:290757 22/62 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..158 7/43 (16%)
p23_NUDCD3_like 184..285 CDD:107244 26/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.