DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nudC and Nudcd3

DIOPT Version :9

Sequence 1:NP_001246805.1 Gene:nudC / 39879 FlyBaseID:FBgn0021768 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_038947459.1 Gene:Nudcd3 / 100125378 RGDID:1642416 Length:363 Species:Rattus norvegicus


Alignment Length:384 Identity:94/384 - (24%)
Similarity:178/384 - (46%) Gaps:86/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAEEGKFDNILLAVAEKHHGGVPEFLGTLASFLRRKTDFF-------------TGAKQTEWEKLL 53
            |||  .:|..||.:.: |.|.|.:||..|..||.|||||:             .||.|.    |:
  Rat     5 AAE--LYDQALLGILQ-HVGNVQDFLRVLFGFLYRKTDFYRLLRHPTDRMGFPPGAAQA----LV 62

  Fly    54 LDVFNKESKLAVTENYEKIKAREASQRLKAEKERAERKARKQEIDDNKICDITDEEAAAIIKEEE 118
            |.||         :.::.:..::..:|    |:..|.|.||:|.:...:...|.|:.|..:..:|
  Rat    63 LQVF---------KTFDHMARQDDEKR----KKELEEKIRKKEEEAKAVAAATAEKEAVPVPVQE 114

  Fly   119 TK-------------KRQQLLDSAGGE--------------PSASNRDGISKP--IEKVDDESDK 154
            .:             ::::|....|.|              .::|..:|...|  :.::.::..|
  Rat   115 VEIDATTALSGPREVEKEELPGPQGPERKVTHGSEEAEAPGTASSAAEGPKDPPVLPRIQEQFQK 179

  Fly   155 SELGKLMPNAGNGCTLENYTWTQTLEEVELKIPFNLTFGLRARDLVISIGKKSLKVGI---KGQT 216
            :      |::.||...|||||:|...::|:::|.. ...::.:.:.:::...|::|.:   .|:.
  Rat   180 N------PDSYNGAIRENYTWSQDYTDLEVRVPVP-KHVVKGKQVSVALSSGSIRVAMLEENGER 237

  Fly   217 PIIDGELCGEVKTEESVWVLQDSKTVMITLDKINKMNWWSRLVTTDPEISTRKINPESSKLSDLD 281
            .:::|:|..::.||.|:|.|:..|.|::.|.|:.:. |||.::..:..|...|||.|.| ::.:|
  Rat   238 VLMEGKLTHKINTESSLWSLEPGKCVLVNLSKVGEY-WWSAILEGEEPIDIDKINKERS-MATVD 300

  Fly   282 GETRSMVEKMMYDQRQKELGLPTSEDRKKQDILEK--------FKQQHPEMDFSKCKFN 332
            .|.:::::::.:|..||..|.|.|.:.|..::|:|        |:.|.    |....||
  Rat   301 EEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAEGSPFRGQR----FDPAMFN 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nudCNP_001246805.1 Nudc_N 7..58 CDD:290757 22/63 (35%)
p23_mNUDC_like 173..259 CDD:107241 23/88 (26%)
Nudcd3XP_038947459.1 Nudc_N 9..67 CDD:404860 23/71 (32%)
p23_NUDCD3_like 186..287 CDD:107244 27/102 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.