DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9674 and NDB3

DIOPT Version :9

Sequence 1:NP_001246804.1 Gene:CG9674 / 39878 FlyBaseID:FBgn0036663 Length:2115 Species:Drosophila melanogaster
Sequence 2:NP_193880.5 Gene:NDB3 / 828234 AraportID:AT4G21490 Length:580 Species:Arabidopsis thaliana


Alignment Length:374 Identity:76/374 - (20%)
Similarity:139/374 - (37%) Gaps:116/374 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1763 EVRTGKR-VAIVGSGPSGLAASQQLNRAGHFVTVFE-RN----------------------DRVG 1803
            |.:|.|| |.::|:|.:|.:..:.||.:.:.|.|.. ||                      :.:.
plant    50 ETKTRKRKVVLLGTGWAGASFLKTLNNSSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIR 114

  Fly  1804 GLL-QYGIPTMKLSKEVVK-----RRVDLMADEGIEFRTNVHVGKDLKAEQLLQEYDAVLLTTGS 1862
            .:. :..:....|..|..|     ::|...:.:|:..:     ||    ::...:||.:::.||:
plant   115 NIARKQNVEMSFLEAECFKIDPGSKKVYCRSKQGVNSK-----GK----KEFDVDYDYLVIATGA 170

  Fly  1863 TWPRDLPLANR-DLKGI----HFAMEFLEAQ----------QKKQLGGKNDIISAAGKNVIIIGG 1912
            .       :|. ::.|:    ||..|..:||          :|..|.|.|:.......:.:::||
plant   171 Q-------SNTFNIPGVEENCHFLKEVEDAQRIRSTVIDSFEKASLPGLNEQERKRMLHFVVVGG 228

  Fly  1913 GDTGCDCIA----------TSLRQGAKSITTFEILPEPPQKRAQDNPWPQWPKVFRVDYGHEEVK 1967
            |.||.:..:          ..|...||::....:|      .|.|:....:.|  |:....||..
plant   229 GPTGVEFASELHDFVNEDLVKLYPKAKNLVQITLL------EAADHILTMFDK--RITEFAEEKF 285

  Fly  1968 LKWGKDPRQYCTTTKEFVGENGAIKGVNTVEVEWTKTETGQWRMQEVAGSEKYFPADLILLAMGF 2032
            .:.|.|.:......|           ||..|:. .||:         ||.....|..:|:.:.| 
plant   286 TRDGIDVKLGSMVVK-----------VNDKEIS-AKTK---------AGEVSTIPYGMIVWSTG- 328

  Fly  2033 LGPE---KTVPSELGLELDPRGNIKA-SNGQY----GTSNSKVFAAGDC 2073
            :|..   |....::|     :||.:| :..::    |..|  ::|.|||
plant   329 IGTRPVIKDFMKQIG-----QGNRRALATDEWLRVEGCDN--IYALGDC 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9674NP_001246804.1 gltB 75..1565 CDD:236968
GATase_2 88..504 CDD:278726
Glu_syn_central 543..828 CDD:282720
GltS_FMN 918..1271 CDD:239202
gltB_C 1316..1565 CDD:238482
gltD 1623..2106 CDD:237213 76/374 (20%)
Fer4_8 1645..1756 CDD:302761
NAD_binding_8 1772..>1804 CDD:290186 9/54 (17%)
NDB3NP_193880.5 PTZ00318 54..580 CDD:185553 74/370 (20%)
NADB_Rossmann 234..313 CDD:304358 18/107 (17%)
EFh <373..407 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.