DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9674 and MDAR4

DIOPT Version :9

Sequence 1:NP_001246804.1 Gene:CG9674 / 39878 FlyBaseID:FBgn0036663 Length:2115 Species:Drosophila melanogaster
Sequence 2:NP_189420.1 Gene:MDAR4 / 822402 AraportID:AT3G27820 Length:488 Species:Arabidopsis thaliana


Alignment Length:419 Identity:93/419 - (22%)
Similarity:144/419 - (34%) Gaps:126/419 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1715 EFTGRVCPAPCEGSCVLGISEPAVTIKNIECAIIDHAFEQGWIKPEIPEVRTGKRVAIVGSGPSG 1779
            |||.|   ...:|...:...||....:.       .|..:|::.||.|.                
plant    22 EFTRR---GVSDGELCIISEEPVAPYER-------PALSKGFLLPEAPA---------------- 60

  Fly  1780 LAASQQLNRAGHFVTVFERNDRVGGLLQYGIPTMKLSKEVVKRRVDLMADEGIEFRTNVHV-GKD 1843
                    |...|.|....||.            ||:.:..|       |.|||......| ..|
plant    61 --------RLPSFHTCVGANDE------------KLTPKWYK-------DHGIELVLGTRVKSVD 98

  Fly  1844 LKAEQLLQ------EYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKND---- 1898
            ::.:.||.      .|..:::.||:          |.||...|.:|..:|:....|....|    
plant    99 VRRKTLLSSTGETISYKFLIIATGA----------RALKLEEFGVEGSDAENVCYLRDLADANRL 153

  Fly  1899 ---IISAAGKNVIIIGGGDTGCDCIATSLRQGAKSITTFEILPEPPQKRAQDNPWPQWPKVFRV- 1959
               |.|::..|.::||||..|.:|.|:.:   ...|....:.||     |........||:..: 
plant   154 ATVIQSSSNGNAVVIGGGYIGMECAASLV---INKINVTMVFPE-----AHCMARLFTPKIASLY 210

  Fly  1960 -DYGHEEVKLKWGKDPRQYCTTTKEFVGENGAIKGVNTVEVEWTKTETGQWRMQEVAGSEKYFPA 2023
             ||    .:.|..|..:....|:.|| ..|..:..||..:                 ||  :.||
plant   211 EDY----YRAKGVKFIKGTVLTSFEF-DSNKKVTAVNLKD-----------------GS--HLPA 251

  Fly  2024 DLILLAMGFLGPEKTVPSELGLELDPRGNIKASNGQYGTSNSKVFAAGDCRR------GQSLVVW 2082
            ||:::.:|..........:|.:|   :|.||. |.:..:|:|.|:|.||...      |:...:.
plant   252 DLVVVGIGIRPNTSLFEGQLTIE---KGGIKV-NSRMQSSDSSVYAIGDVATFPVKLFGEMRRLE 312

  Fly  2083 AITEGRQAARQ-----VDSYLTGRPSGLP 2106
            .:...|::||.     :|...||....||
plant   313 HVDSARKSARHAVSAIMDPIKTGDFDYLP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9674NP_001246804.1 gltB 75..1565 CDD:236968
GATase_2 88..504 CDD:278726
Glu_syn_central 543..828 CDD:282720
GltS_FMN 918..1271 CDD:239202
gltB_C 1316..1565 CDD:238482
gltD 1623..2106 CDD:237213 91/417 (22%)
Fer4_8 1645..1756 CDD:302761 8/40 (20%)
NAD_binding_8 1772..>1804 CDD:290186 5/31 (16%)
MDAR4NP_189420.1 Pyr_redox_2 29..321 CDD:400379 82/387 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.