DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9674 and PYD1

DIOPT Version :10

Sequence 1:NP_001246804.1 Gene:CG9674 / 39878 FlyBaseID:FBgn0036663 Length:2115 Species:Drosophila melanogaster
Sequence 2:NP_188408.1 Gene:PYD1 / 821049 AraportID:AT3G17810 Length:426 Species:Arabidopsis thaliana


Alignment Length:172 Identity:37/172 - (21%)
Similarity:53/172 - (30%) Gaps:60/172 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TGRLCLFGFCSENCISSYNY-----GEKVMKNLEEVKELLSKKHFEVVAHKIPVPKVE------- 147
            ||.....|:.:...:||...     |....:..|.|..:....|.|         |||       
plant    47 TGGAKGIGYSTAKHLSSLGMHVIIAGNNEAEGSEAVTRIQQDTHNE---------KVEFLYCDLA 102

  Fly   148 -EKNIHTTVGLYAMVEMAWKSLMNDEIRTLCLHGMGGVGKTTLLACINNKFVELESE------FD 205
             .|:|...|.::             :.:.||||           ..:||..|.|..|      |:
plant   103 SMKSIRQFVQIF-------------KAKNLCLH-----------VLVNNAGVMLVPERKTADGFE 143

  Fly   206 VVIWVVVSKDFQLEGIQDQILGRLRLDKEWERETENKKASLI 247
                    :.|.|..:...:|..|.|....|..|||..|.:|
plant   144 --------EHFGLNYLGHFLLTNLLLKTTKESGTENLNARII 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9674NP_001246804.1 gltB 75..1565 CDD:236968 37/172 (22%)
gltD 1623..2106 CDD:237213
PYD1NP_188408.1 PLN02495 44..426 CDD:215273 37/172 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.