DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9674 and dare

DIOPT Version :9

Sequence 1:NP_001246804.1 Gene:CG9674 / 39878 FlyBaseID:FBgn0036663 Length:2115 Species:Drosophila melanogaster
Sequence 2:NP_477150.1 Gene:dare / 36203 FlyBaseID:FBgn0015582 Length:466 Species:Drosophila melanogaster


Alignment Length:402 Identity:96/402 - (23%)
Similarity:156/402 - (38%) Gaps:94/402 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1768 KRVAIVGSGPSGLAASQ----QLNRAGHFVTVFERNDRVGGLLQYGI-PTMKLSKEVVKRRVDLM 1827
            ||:.|||:||:|..|:|    ||:..  .|.|.|:.....||:::|: |.....|.|:.......
  Fly    30 KRICIVGAGPAGFYAAQLILKQLDNC--VVDVVEKLPVPFGLVRFGVAPDHPEVKNVINTFTKTA 92

  Fly  1828 ADEGIEFRTNVHVGKDLKAEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQ 1892
            ....:.:..|:.:|.|:...:|...|.|||||.|:...|.|.|.|..|..:..|.:|: |.....
  Fly    93 EHPRLRYFGNISLGTDVSLRELRDRYHAVLLTYGADQDRQLELENEQLDNVISARKFV-AWYNGL 156

  Fly  1893 LGGKNDIISAAGKNVIIIGGGDTGCDCIATSL--------------------------------R 1925
            .|.:|.....:|::|.|:|.|:...| :|..|                                |
  Fly   157 PGAENLAPDLSGRDVTIVGQGNVAVD-VARMLLSPLDALKTTDTTEYALEALSCSQVERVHLVGR 220

  Fly  1926 QG-AKSITTFEILPEPPQKRAQDNPWPQWPKVFRVDYGHEEVKLKWGKDPRQYCTTTK-EFVGEN 1988
            :| .::..|.:.|.|..:....|..|.      ..|:...:::|...:.||:..|... :.:.|.
  Fly   221 RGPLQAAFTIKELREMLKLPNVDTRWR------TEDFSGIDMQLDKLQRPRKRLTELMLKSLKEQ 279

  Fly  1989 GAIKG--------------VNTVEVEWTKTETGQWRMQEVAGSEKYFPADLILLAMGFLGPEKTV 2039
            |.|.|              :...|:|::.||..|......:.:|: .|:.|||.::|:    |:.
  Fly   280 GRISGSKQFLPIFLRAPKAIAPGEMEFSVTELQQEAAVPTSSTER-LPSHLILRSIGY----KSS 339

  Fly  2040 PSELGLELDP-RGNIKASNGQYGTSNSKVFAAGDCRRGQSLVVWAITEGRQAARQVDSYLTGRPS 2103
            ..:.|:..|. ||.:...||:.    .|..|.|:...|..:..|..|                  
  Fly   340 CVDTGINFDTRRGRVHNINGRI----LKDDATGEVDPGLYVAGWLGT------------------ 382

  Fly  2104 GLPGPGGVIATS 2115
               ||.|||.|:
  Fly   383 ---GPTGVIVTT 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9674NP_001246804.1 gltB 75..1565 CDD:236968
GATase_2 88..504 CDD:278726
Glu_syn_central 543..828 CDD:282720
GltS_FMN 918..1271 CDD:239202
gltB_C 1316..1565 CDD:238482
gltD 1623..2106 CDD:237213 90/391 (23%)
Fer4_8 1645..1756 CDD:302761
NAD_binding_8 1772..>1804 CDD:290186 13/35 (37%)
dareNP_477150.1 PLN02852 10..465 CDD:215457 96/402 (24%)
NAD_binding_8 34..98 CDD:290186 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11938
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.