DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46388 and CG14491

DIOPT Version :10

Sequence 1:NP_001356964.1 Gene:CG46388 / 39877389 FlyBaseID:FBgn0286834 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster


Alignment Length:180 Identity:36/180 - (20%)
Similarity:62/180 - (34%) Gaps:45/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FMAISLAGGEPRKLIVFDTIECAIKSSVISKVVCQLYSRTEFTVFLTFGEKKHADKVFGACEVKL 78
            |...|.:..:|..::  ..::|.:..||         .|..|.:.|.|  ||...|.|....:.|
  Fly     3 FTNCSCSSEDPEGML--SLLKCGLSKSV---------KRPSFNIELQF--KKPVAKFFVNMRIVL 54

  Fly    79 CPKSQKKITRINNLRLDFCQL-------------KKHTESRSVLGMFYLALRRAVVNFPNKCPFK 130
            ..:.....|..|...:|.|.|             :||.:..|              |.|.:||:.
  Fly    55 PRRFGDDFTLFNLSGIDGCSLLSNKNQIAFIQLGRKHMDRFS--------------NIPKRCPWP 105

  Fly   131 KNTTYGVNRFHFGWQDIPQYLPDTNYTLVGKIYANNELGLEIKVTGGYFE 180
            |:..|.:..|......:|.:..:|:..|..::..|..     |:..|:.:
  Fly   106 KDVNYYIRGFRSDMATMPAFNFETDMNLWFELVVNQH-----KLIRGFIQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46388NP_001356964.1 DUF1091 87..158 CDD:461928 17/83 (20%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 21/108 (19%)

Return to query results.
Submit another query.