DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9706 and YBR219C

DIOPT Version :10

Sequence 1:NP_001356982.1 Gene:CG9706 / 39876 FlyBaseID:FBgn0036662 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_009778.3 Gene:YBR219C / 852520 SGDID:S000000423 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:99 Identity:34/99 - (34%)
Similarity:54/99 - (54%) Gaps:4/99 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 MTFLNTLCNLGGNWPNTVVLWLVDVLTWKQCS---NNAENTCQGKEEQQSCEASAGKCEITFDGY 484
            ||.||||.|.||.||..:::.:::..|..||:   .|......|...|...|...|...|..|||
Yeast     1 MTLLNTLSNFGGTWPRLIIMSMINYFTVYQCTIPGTNKVYVTHGGSMQACTELLNGTVTILRDGY 65

  Fly   485 YLESGICVLYGI-VWLLLVRKWIVYLQDLPVRSW 517
            |:.:.||::.|: ::...:::.|::||.||:.||
Yeast    66 YITNLICIVVGLFLYFGYLKRKILHLQSLPISSW 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9706NP_001356982.1 MFS 43..517 CDD:475125 32/97 (33%)
YBR219CNP_009778.3 MFS <1..100 CDD:475125 34/99 (34%)

Return to query results.
Submit another query.