DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and cspG

DIOPT Version :10

Sequence 1:NP_648920.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_415510.1 Gene:cspG / 945591 ECOCYCID:G6511 Length:70 Species:Escherichia coli


Alignment Length:34 Identity:18/34 - (52%)
Similarity:25/34 - (73%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIE 88
            :||:||.|:..||.|||||:.|.:|||.|.:.|:
E. coli     5 MTGLVKWFNADKGFGFITPDDGSKDVFVHFTAIQ 38

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_648920.1 CSP_CDS 55..120 CDD:239905 18/34 (53%)
cspGNP_415510.1 PRK09890 1..70 CDD:77467 18/34 (53%)

Return to query results.
Submit another query.