DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and GRP2B

DIOPT Version :10

Sequence 1:NP_648920.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_179702.1 Gene:GRP2B / 816641 AraportID:AT2G21060 Length:201 Species:Arabidopsis thaliana


Alignment Length:34 Identity:19/34 - (55%)
Similarity:22/34 - (64%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGE 90
            |.||.|...||.|||||:.||:|:|.|.|.|..|
plant    17 GTVKWFDTQKGFGFITPSDGGDDLFVHQSSIRSE 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_648920.1 CSP_CDS 55..120 CDD:239905 19/34 (56%)
GRP2BNP_179702.1 CSD 15..81 CDD:278729 19/34 (56%)
PTZ00368 <135..>198 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.