DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and lin28aa

DIOPT Version :10

Sequence 1:NP_648920.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_017206944.1 Gene:lin28aa / 799825 ZFINID:ZDB-GENE-110914-157 Length:193 Species:Danio rerio


Alignment Length:54 Identity:16/54 - (29%)
Similarity:24/54 - (44%) Gaps:9/54 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GMVKSFSRTKGHGFITPNAGG-------EDVFCHVSDI--EGEYVPMPGDEVKY 101
            |:.|.|:...|.||::.|...       .|||.|.|.:  ||......|:.|::
Zfish    28 GVCKWFNVRMGFGFLSMNTRDGVPLETPVDVFVHQSKLHMEGFRSLKEGESVEF 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_648920.1 CSP_CDS 55..120 CDD:239905 16/54 (30%)
lin28aaXP_017206944.1 CSP_CDS 28..97 CDD:239905 16/54 (30%)
PTZ00368 <125..179 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.