DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and Carhsp1

DIOPT Version :9

Sequence 1:NP_001261972.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_006522410.1 Gene:Carhsp1 / 52502 MGIID:1196368 Length:174 Species:Mus musculus


Alignment Length:129 Identity:67/129 - (51%)
Similarity:84/129 - (65%) Gaps:13/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRTPEKLLAAKPPVLHHNSHSPNASLQLPSPIITRRTRTASTSARALENPVVTGMVKSFSRTKGH 68
            |||.::            |.||.....:|||:.||||||.|.:.||.:.||..|:.|.|.|:|||
Mouse    51 PRTRDR------------SPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGH 103

  Fly    69 GFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQISHLTPEVHHK-W 131
            |||||..||.|:|.|:||:||||||:.||||.|::|:||||.||.|||.|.|:||.|...|: |
Mouse   104 GFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETW 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_001261972.1 CSP_CDS 55..120 CDD:239905 41/64 (64%)
Carhsp1XP_006522410.1 CSP_CDS 90..155 CDD:239905 41/64 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850744
Domainoid 1 1.000 96 1.000 Domainoid score I7328
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8632
Inparanoid 1 1.050 134 1.000 Inparanoid score I4562
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45225
OrthoDB 1 1.010 - - D1560417at2759
OrthoFinder 1 1.000 - - FOG0004241
OrthoInspector 1 1.000 - - otm42799
orthoMCL 1 0.900 - - OOG6_108966
Panther 1 1.100 - - O PTHR12962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4832
SonicParanoid 1 1.000 - - X357
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.