DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and Ybx1

DIOPT Version :9

Sequence 1:NP_001261972.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_008762280.1 Gene:Ybx1 / 500538 RGDID:61843 Length:326 Species:Rattus norvegicus


Alignment Length:47 Identity:19/47 - (40%)
Similarity:25/47 - (53%) Gaps:4/47 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIE----GEYVPMPGD 97
            |.|.||.|:...|:|||..|...||||.|.:.|:    .:|:...||
  Rat    57 VLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGD 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_001261972.1 CSP_CDS 55..120 CDD:239905 19/47 (40%)
Ybx1XP_008762280.1 CSD 57..126 CDD:278729 19/47 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.