powered by:
Protein Alignment CG9705 and Ybx1
DIOPT Version :9
Sequence 1: | NP_001261972.1 |
Gene: | CG9705 / 39875 |
FlyBaseID: | FBgn0036661 |
Length: | 143 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008762280.1 |
Gene: | Ybx1 / 500538 |
RGDID: | 61843 |
Length: | 326 |
Species: | Rattus norvegicus |
Alignment Length: | 47 |
Identity: | 19/47 - (40%) |
Similarity: | 25/47 - (53%) |
Gaps: | 4/47 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 VTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIE----GEYVPMPGD 97
|.|.||.|:...|:|||..|...||||.|.:.|: .:|:...||
Rat 57 VLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGD 103
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9705 | NP_001261972.1 |
CSP_CDS |
55..120 |
CDD:239905 |
19/47 (40%) |
Ybx1 | XP_008762280.1 |
CSD |
57..126 |
CDD:278729 |
19/47 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1278 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.