DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and csdc2a

DIOPT Version :9

Sequence 1:NP_001261972.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001002690.1 Gene:csdc2a / 436963 ZFINID:ZDB-GENE-040718-442 Length:153 Species:Danio rerio


Alignment Length:133 Identity:66/133 - (49%)
Similarity:84/133 - (63%) Gaps:8/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRTPEKLLAAKPPVLHHNS----HSPNASLQLPSPIITRRTRTASTSARALENPVVTGMVKSFSR 64
            |.||   |:...|.|...|    ..|..:.:..||:.|:||||.|.|.||...||..|:.|:|||
Zfish    17 PHTP---LSLSLPFLREGSGLLERKPPQTGEPLSPLPTKRTRTYSASVRAKSGPVYKGICKNFSR 78

  Fly    65 TKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQISHLTP-EVH 128
            ::|||||.|:.||||:|.|:||||||||||.||||.|::|.:|||..|.|||.|.|::|:. ..|
Zfish    79 SQGHGFIRPSHGGEDIFVHISDIEGEYVPMEGDEVTYKVCPVPPKNIKFQAVEVVITNLSSGRKH 143

  Fly   129 HKW 131
            ..|
Zfish   144 ETW 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_001261972.1 CSP_CDS 55..120 CDD:239905 41/64 (64%)
csdc2aNP_001002690.1 CSP_CDS 69..134 CDD:239905 41/64 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596755
Domainoid 1 1.000 98 1.000 Domainoid score I7107
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4436
OMA 1 1.010 - - QHG45225
OrthoDB 1 1.010 - - D1560417at2759
OrthoFinder 1 1.000 - - FOG0004241
OrthoInspector 1 1.000 - - otm25901
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12962
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X357
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.