DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and yps

DIOPT Version :9

Sequence 1:NP_001261972.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_524033.2 Gene:yps / 39377 FlyBaseID:FBgn0022959 Length:352 Species:Drosophila melanogaster


Alignment Length:88 Identity:25/88 - (28%)
Similarity:38/88 - (43%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TEPRTPEKLLAAKPPVLHHNSHSPNASLQLPSPI--ITRRTRTASTSARALENPVVTGMVKSFSR 64
            ::|...|:..|.:.|....|..:|........|:  :..:....:...:.:....|||.||.|:.
  Fly     7 SKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNV 71

  Fly    65 TKGHGFITPNAGGEDVFCHVSDI 87
            ..|:|||..|...||||.|.|.|
  Fly    72 KSGYGFINRNDTREDVFVHQSAI 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_001261972.1 CSP_CDS 55..120 CDD:239905 18/33 (55%)
ypsNP_524033.2 CSD 62..131 CDD:278729 18/33 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.