powered by:
Protein Alignment CG9705 and lin-28
DIOPT Version :9
Sequence 1: | NP_001261972.1 |
Gene: | CG9705 / 39875 |
FlyBaseID: | FBgn0036661 |
Length: | 143 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647983.1 |
Gene: | lin-28 / 38639 |
FlyBaseID: | FBgn0035626 |
Length: | 195 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 27/73 - (36%) |
Similarity: | 38/73 - (52%) |
Gaps: | 15/73 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 SLQLPSPIITRRTRTASTSARALENP------------VVTGMVKSFSRTKGHGFITPNAGGEDV 80
::||.:.:..|.|..:|||: .|| |..|..|.|:..||.||:|||.||::|
Fly 3 NVQLENGLERRTTSQSSTSS---ANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEV 64
Fly 81 FCHVSDIE 88
|.|.|.|:
Fly 65 FVHQSVIQ 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1278 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.