DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and Lin28b

DIOPT Version :9

Sequence 1:NP_001261972.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_011241482.1 Gene:Lin28b / 380669 MGIID:3584032 Length:303 Species:Mus musculus


Alignment Length:183 Identity:40/183 - (21%)
Similarity:60/183 - (32%) Gaps:64/183 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PEKL--LAA-KPPVLHHNSH--------------------SPNASLQLPSPIITRRTR------- 41
            ||||  ||. :|.|||...|                    :|   |.:|..:...:::       
Mouse    44 PEKLPGLAEDEPQVLHGTGHCKWFNVRMGFGFISMISREGNP---LDIPVDVFVHQSKLFMEGFR 105

  Fly    42 ----------TASTSARALENPVVTG-----MVKSFSRTKGHGFITPNAGGE---------DVFC 82
                      |...|.:.||:..|||     .:.|..|.||.........|:         |...
Mouse   106 SLKEGEPVEFTFKKSPKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPKGDRWRRQDLLMDQMW 170

  Fly    83 HVSDIEGEYVP----MPGDEVKYRLCAIPPKYEK-HQAVHVQISHLTPEVHHK 130
            .|.:.|...:|    ..|.:...:.|::||:.:| |..  ..|.|:.....||
Mouse   171 TVREEESRMIPRCYNCGGLDHHAKECSLPPQPKKCHYC--QSIMHMVANCPHK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_001261972.1 CSP_CDS 55..120 CDD:239905 18/83 (22%)
Lin28bXP_011241482.1 CSP_CDS 61..131 CDD:239905 9/72 (13%)
PTZ00368 <183..219 CDD:173561 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.