DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and CSDC2

DIOPT Version :9

Sequence 1:NP_001261972.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_055275.1 Gene:CSDC2 / 27254 HGNCID:30359 Length:153 Species:Homo sapiens


Alignment Length:149 Identity:68/149 - (45%)
Similarity:85/149 - (57%) Gaps:24/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AAKPPVLHHNSHSPNASL----------------------QLPSPIITRRTRTASTSARALENPV 54
            :..|||: ...|||.:.:                      .||||:.|:||||.|.:|||...||
Human     5 STSPPVV-PPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPV 68

  Fly    55 VTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQ 119
            ..|:.|.|||::|||||||..|.||:|.|||||||||||:.||||.|::|.||||.:|.|||.|.
Human    69 FKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVV 133

  Fly   120 ISHLTPEV-HHKWEEPFYG 137
            ::.|.|.. |..|.....|
Human   134 LTQLAPHTPHETWSGQVVG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_001261972.1 CSP_CDS 55..120 CDD:239905 42/64 (66%)
CSDC2NP_055275.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 16/57 (28%)
CSP_CDS 70..134 CDD:239905 42/63 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160389
Domainoid 1 1.000 96 1.000 Domainoid score I7352
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4595
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45225
OrthoDB 1 1.010 - - D1560417at2759
OrthoFinder 1 1.000 - - FOG0004241
OrthoInspector 1 1.000 - - otm40725
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4832
SonicParanoid 1 1.000 - - X357
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.