DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and Csdc2

DIOPT Version :9

Sequence 1:NP_001261972.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001164013.1 Gene:Csdc2 / 266600 RGDID:628780 Length:154 Species:Rattus norvegicus


Alignment Length:151 Identity:72/151 - (47%)
Similarity:86/151 - (56%) Gaps:18/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TEPRTPEKLLAAKPPV-----LHHNSH---------SPNASLQLPSPIITRRTRTASTSARALEN 52
            |.|.....|.:.|.||     .|..|.         ||.   .||||:.|:||||.|.:|||...
  Rat     6 TSPPVVPPLHSPKSPVWPTFPFHRESSRIWERGGGVSPR---DLPSPLPTKRTRTYSATARASAG 67

  Fly    53 PVVTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVH 117
            ||..|:.|.|||::|||||||..|.||:|.|||||||||||:.||||.|::|.||||.:|.|||.
  Rat    68 PVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVE 132

  Fly   118 VQISHLTPEV-HHKWEEPFYG 137
            |.::.|.|.. |..|.....|
  Rat   133 VVLTQLAPHTPHETWSGQVVG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_001261972.1 CSP_CDS 55..120 CDD:239905 42/64 (66%)
Csdc2NP_001164013.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 5/15 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..62 12/28 (43%)
CSP_CDS 71..135 CDD:239905 42/63 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354450
Domainoid 1 1.000 96 1.000 Domainoid score I7161
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4485
OMA 1 1.010 - - QHG45225
OrthoDB 1 1.010 - - D1560417at2759
OrthoFinder 1 1.000 - - FOG0004241
OrthoInspector 1 1.000 - - otm44864
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12962
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X357
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.