powered by:
Protein Alignment CG9705 and cey-1
DIOPT Version :9
Sequence 1: | NP_001261972.1 |
Gene: | CG9705 / 39875 |
FlyBaseID: | FBgn0036661 |
Length: | 143 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_496366.1 |
Gene: | cey-1 / 174690 |
WormBaseID: | WBGene00000472 |
Length: | 208 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 20/61 - (32%) |
Similarity: | 30/61 - (49%) |
Gaps: | 10/61 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 ENPV----VTGMVKSFSRTKGHGFITPNAGGEDVFCH----VSDIEGEYVPMPGD--EVKY 101
:.|| |.|.||.|:...|:|||......||:|.| :::...:|:...|| ||.:
Worm 13 DKPVKATKVKGTVKWFNVKNGYGFINRTDTNEDIFVHQTAIINNNPNKYLRSLGDNEEVMF 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9705 | NP_001261972.1 |
CSP_CDS |
55..120 |
CDD:239905 |
18/53 (34%) |
cey-1 | NP_496366.1 |
CSD |
21..90 |
CDD:278729 |
18/53 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1278 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.