DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and Csdc2

DIOPT Version :9

Sequence 1:NP_001261972.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_663448.2 Gene:Csdc2 / 105859 MGIID:2146027 Length:154 Species:Mus musculus


Alignment Length:155 Identity:72/155 - (46%)
Similarity:87/155 - (56%) Gaps:26/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TPEKLLAAKPPVLH--HNSHSP--------------------NASLQLPSPIITRRTRTASTSAR 48
            |.|..|   |||:.  |:..||                    .|...||||:.|:||||.|.:||
Mouse     2 TSESTL---PPVVPPLHSPKSPVWPTFPFHREGSRIWERGGGIAPRDLPSPLPTKRTRTYSATAR 63

  Fly    49 ALENPVVTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKH 113
            |...||..|:.|.|||::|||||||..|.||:|.|||||||||||:.||||.|::|.||||.:|.
Mouse    64 ASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKICPIPPKNQKF 128

  Fly   114 QAVHVQISHLTPEV-HHKWEEPFYG 137
            |||.|.::.|.|.. |..|.....|
Mouse   129 QAVEVVLTQLAPHTPHETWSGQVVG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_001261972.1 CSP_CDS 55..120 CDD:239905 42/64 (66%)
Csdc2NP_663448.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..62 11/23 (48%)
CSP_CDS 71..135 CDD:239905 42/63 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850743
Domainoid 1 1.000 96 1.000 Domainoid score I7328
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4562
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45225
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004241
OrthoInspector 1 1.000 - - otm42799
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4832
SonicParanoid 1 1.000 - - X357
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.890

Return to query results.
Submit another query.