DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9705 and csdc2

DIOPT Version :9

Sequence 1:NP_001261972.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001093718.1 Gene:csdc2 / 100101738 XenbaseID:XB-GENE-489696 Length:151 Species:Xenopus tropicalis


Alignment Length:142 Identity:68/142 - (47%)
Similarity:93/142 - (65%) Gaps:12/142 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TEPRTP-EKLLAAKPPV-LHHNSHSPNASL---------QLPSPIITRRTRTASTSARALENPVV 55
            ::|.|| :.|.:.|.|| ..:..|...:.|         :||||:.|:||||.|.:|||...|:.
 Frog     3 SDPTTPTQPLHSPKSPVATSYPFHREGSRLWERSHLLLGELPSPLPTKRTRTYSATARASAGPIY 67

  Fly    56 TGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQI 120
            .|:.|.|||::|||||||..|.||:|.|:|||||||||:.||||.:::|.||||.:|.|||.|.:
 Frog    68 KGVCKQFSRSQGHGFITPENGTEDIFVHISDIEGEYVPVEGDEVTFKMCPIPPKNQKFQAVEVIL 132

  Fly   121 SHLTPEVHHK-W 131
            :||:|...|: |
 Frog   133 THLSPHTKHETW 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9705NP_001261972.1 CSP_CDS 55..120 CDD:239905 40/64 (63%)
csdc2NP_001093718.1 CSP_CDS 67..132 CDD:239905 40/64 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45225
OrthoDB 1 1.010 - - D1560417at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4832
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.