DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus302 and AT5G03750

DIOPT Version :10

Sequence 1:NP_648919.1 Gene:mus302 / 39874 FlyBaseID:FBgn0287696 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_195995.1 Gene:AT5G03750 / 831735 AraportID:AT5G03750 Length:169 Species:Arabidopsis thaliana


Alignment Length:134 Identity:31/134 - (23%)
Similarity:51/134 - (38%) Gaps:31/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 SCALDRNEREHFLYGGDLRGGVYIYDLRFPENILCEFQAEVNLSPVIHIAPVQPNKIFTSGGFLV 447
            ||:.|.| ..|.:|.|...|.|.::|:|            .|..|::.:|.|..|.:....||.|
plant    41 SCSWDLN-NYHNVYAGLQNGMVLVFDMR------------QNRGPLVSLADVTSNSVHIVDGFHV 92

  Fly   448 C-QLTALTFYEYAAASDTAVPTR-----------------LNVEGPFLSMQYDAVQDTVLISARS 494
            | :......|....:|..|:.||                 |:.:.|...::|..:..:.|:...:
plant    93 CLKRRGDGSYSQKQSSTQAISTRELILQDPWSFAVSQRFALSSQLPLQDVKYANLNGSGLLGLLT 157

  Fly   495 NPNF 498
            |..|
plant   158 NDRF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus302NP_648919.1 mRING-C3HGC3_RFWD3 127..192 CDD:438114
WD40 <293..445 CDD:475233 16/61 (26%)
WD40 repeat 339..375 CDD:293791
AT5G03750NP_195995.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.