DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus302 and CG17329

DIOPT Version :10

Sequence 1:NP_648919.1 Gene:mus302 / 39874 FlyBaseID:FBgn0287696 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster


Alignment Length:182 Identity:56/182 - (30%)
Similarity:80/182 - (43%) Gaps:46/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VEGLQPAVEIDEQRDQPGENAEPEQPRVPPLI--LVD----PPHLPSPPRN-SRRNQGEEQEVIS 90
            :|.::..:|..||:.|  |..||....:...:  |.|    ..||.:..|. .|..||:..:..:
  Fly     1 MEKIEKELERTEQQQQ--EPTEPSNGNLEEQVRKLRDHNLRVKHLNTQRRRILRLLQGKMLQYAT 63

  Fly    91 LETPSPPKKRKRLSAAAD-----------KSLKKSPEGKPIVVDDEDDGMTCPICLDSWEMSGEH 144
            ||        :||....:           |:|.:.       :|...:..||.|||..|..:|.|
  Fly    64 LE--------ERLHRIGELVLIAELHSGVKTLNQR-------LDRMVENSTCSICLLPWTDNGIH 113

  Fly   145 RLVSLRCGHLFGESCIRRWLNESHRQSSVKVCPQCKTKATFRDIRHLYAKRI 196
            ||||||||||||.|||...:..:||      ||.|:.:|     ||.:.:||
  Fly   114 RLVSLRCGHLFGSSCIHMAIRRNHR------CPICRRRA-----RHFHVRRI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus302NP_648919.1 mRING-C3HGC3_RFWD3 127..192 CDD:438114 31/64 (48%)
WD40 <293..445 CDD:475233
WD40 repeat 339..375 CDD:293791
CG17329NP_609784.2 HRD1 <36..>144 CDD:227568 41/128 (32%)
RING_Ubox 96..155 CDD:473075 33/70 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.