DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus302 and CG33552

DIOPT Version :10

Sequence 1:NP_648919.1 Gene:mus302 / 39874 FlyBaseID:FBgn0287696 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster


Alignment Length:136 Identity:39/136 - (28%)
Similarity:62/136 - (45%) Gaps:32/136 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RRNQGEEQEVI---------------SLETPSPPKKRKRLSAAADKSLKKSPEG-----KPIVVD 123
            |:...|:.|:|               .|:......|..||..||..::....|.     |.|..:
  Fly    22 RKRNKEKDEIIKDSFESKKRLIDLRLQLDKEKNITKELRLRLAAQDAIANQAENLSMKRKKIAEE 86

  Fly   124 DEDDGMTCPICLDSWEMSGEHRLVSLRCGHLFGESCIRRWLNESHRQSSVKVCPQCKTK-ATFRD 187
            ::     |.||..::|::|:||.||::||||||.:||..:|..:      |.||.||:: ....|
  Fly    87 NK-----CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRN------KTCPICKSQMIRCMD 140

  Fly   188 IRHLYA 193
            :|.:.|
  Fly   141 VRIIIA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus302NP_648919.1 mRING-C3HGC3_RFWD3 127..192 CDD:438114 25/65 (38%)
WD40 <293..445 CDD:475233
WD40 repeat 339..375 CDD:293791
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 25/69 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.