DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13025 and CG31807

DIOPT Version :9

Sequence 1:NP_001261971.1 Gene:CG13025 / 39874 FlyBaseID:FBgn0036660 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_723984.1 Gene:CG31807 / 318953 FlyBaseID:FBgn0051807 Length:155 Species:Drosophila melanogaster


Alignment Length:59 Identity:33/59 - (55%)
Similarity:38/59 - (64%) Gaps:6/59 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 TCPICLDSWEMSGEHRLVSLRCGHLFGESCIRRWLNESHRQSSVKVCPQCKTKATFRDI 188
            ||.||||.||....||||||||||||||.|||     :|.|.: .:||.|:..|..||:
  Fly    95 TCCICLDPWEAKDHHRLVSLRCGHLFGEMCIR-----THLQHA-DMCPICRKVAIERDV 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13025NP_001261971.1 zf-RING_2 130..180 CDD:290367 29/49 (59%)
WD40 <293..445 CDD:295369
WD40 <318..>415 CDD:225201
WD40 repeat 339..375 CDD:293791
CG31807NP_723984.1 zf-RING_2 94..139 CDD:290367 29/49 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447440
Domainoid 1 1.000 54 1.000 Domainoid score I4143
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.