powered by:
Protein Alignment CG13025 and CG31807
DIOPT Version :9
Sequence 1: | NP_001261971.1 |
Gene: | CG13025 / 39874 |
FlyBaseID: | FBgn0036660 |
Length: | 608 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_723984.1 |
Gene: | CG31807 / 318953 |
FlyBaseID: | FBgn0051807 |
Length: | 155 |
Species: | Drosophila melanogaster |
Alignment Length: | 59 |
Identity: | 33/59 - (55%) |
Similarity: | 38/59 - (64%) |
Gaps: | 6/59 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 130 TCPICLDSWEMSGEHRLVSLRCGHLFGESCIRRWLNESHRQSSVKVCPQCKTKATFRDI 188
||.||||.||....||||||||||||||.||| :|.|.: .:||.|:..|..||:
Fly 95 TCCICLDPWEAKDHHRLVSLRCGHLFGEMCIR-----THLQHA-DMCPICRKVAIERDV 147
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45447440 |
Domainoid |
1 |
1.000 |
54 |
1.000 |
Domainoid score |
I4143 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1451258at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.850 |
|
Return to query results.
Submit another query.