DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and NLGN2

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_065846.1 Gene:NLGN2 / 57555 HGNCID:14290 Length:835 Species:Homo sapiens


Alignment Length:570 Identity:142/570 - (24%)
Similarity:209/570 - (36%) Gaps:162/570 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 LREGRYIMAVTGCGPVEGVKED-------GAFAFRGIPYAKPPVDRLRWKPAELIDDINMCWNDT 412
            |.|.|:.:..|..|.|.||:.:       ....|.|:|||.||:...|::|.|    ....|...
Human    36 LGEERFPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYATPPLGARRFQPPE----APASWPGV 96

  Fly   413 LQTHNSSVVCTQRL------------------GNGTTVGD--EDCLYLDVVTP------------ 445
            .........|.|.|                  ...|.|.:  ||||||::..|            
Human    97 RNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDE 161

  Fly   446 --------HVRYNNPLPVVVLI-GAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLAL 501
                    .:|.....||::.: |...:.|  .|.:...:..:...:||....|:||||.|||:.
Human   162 ATLNPPDTDIRDPGKKPVMLFLHGGSYMEG--TGNMFDGSVLAAYGNVIVATLNYRLGVLGFLST 224

  Fly   502 -DALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKG 565
             |...|       |||.|.|.|..|.|:..||.||||||:.:|:.|..|||:.|.||:.|...:|
Human   225 GDQAAK-------GNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEG 282

  Fly   566 LYTRAWASSGSAILPGKPLSESGKQNEQLMATLEC------ADIQCLREASSERLWAATPDTWLH 624
            |:.:|.|.||:||.......:..|....|.|.:.|      ..::|||...|..|          
Human   283 LFQKAIAQSGTAISSWSVNYQPLKYTRLLAAKVGCDREDSAEAVECLRRKPSREL---------- 337

  Fly   625 FPVDLP-QPQEAN-ASGSRHEWLVLDGDVVFEHPSDTWKREQANDKPVLV-----MGATAHEAHT 682
              ||.. ||...: |.|.     |:|||||.:.|....::.:..:..:|:     .|....|...
Human   338 --VDQDVQPARYHIAFGP-----VVDGDVVPDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSA 395

  Fly   683 EKLRELHANWTREEVRAYLENSQIGALGLTD------EVIEKYNASSYA----------SLVSII 731
            |....:.|:.....|..:::|    ..|..:      |.| |:..:.:|          :|:::.
Human   396 ESEDGVSASAFDFTVSNFVDN----LYGYPEGKDVLRETI-KFMYTDWADRDNGEMRRKTLLALF 455

  Fly   732 SDIRSVCPLLTNAR-----QQP--SVPFYVVTQGEGPDQLATVDADVQAILGRYEPHTVEQRRFV 789
            :|.:.|.|.:..|:     |.|  ...||...|.||..:.|  ||                    
Human   456 TDHQWVAPAVATAKLHADYQSPVYFYTFYHHCQAEGRPEWA--DA-------------------- 498

  Fly   790 SAMQQLFYYYVSHGTVQSFVQNRRVINVGQDAQPEEDYLPCNYWISKDIV 839
                       :||....:|       .|.......|..|||:  ||:.|
Human   499 -----------AHGDELPYV-------FGVPMVGATDLFPCNF--SKNDV 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 135/554 (24%)
NLGN2NP_065846.1 COesterase 41..601 CDD:278561 139/565 (25%)
Aes <170..>268 CDD:223730 37/106 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..668
Required for interaction with LHFPL4. /evidence=ECO:0000250|UniProtKB:Q69ZK9 678..698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.