DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and NLGN4X

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:XP_005274621.1 Gene:NLGN4X / 57502 HGNCID:14287 Length:836 Species:Homo sapiens


Alignment Length:346 Identity:99/346 - (28%)
Similarity:140/346 - (40%) Gaps:97/346 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 GPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQRLGNGTTV 432
            ||||        .:.|:|||.||....|::|.|....    |.....|...:.||.|.|...:.:
Human    68 GPVE--------QYLGVPYASPPTGERRFQPPEPPSS----WTGIRNTTQFAAVCPQHLDERSLL 120

  Fly   433 GD---------------------EDCLYLDVVTP-------------------------HVRYNN 451
            .|                     ||||||::..|                         |.: |:
Human   121 HDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDGANTKKNADDITSNDRGEDEDIHDQ-NS 184

  Fly   452 PLPVVVLIGAESLAGPSPGILRPS--ARYSRSHDVIFVRPNFRLGVFGFLAL-DALTKEAHPPTS 513
            ..||:|.|...|....:..::..|  |.|.   :||.:..|:|||:.|||:. |...|       
Human   185 KKPVMVYIHGGSYMEGTGNMIDGSILASYG---NVIVITINYRLGILGFLSTGDQAAK------- 239

  Fly   514 GNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAI 578
            |||.|.|.|..|.||:.|:..|||||:.||:.|..|||:.|:||..|...:||:.:|...||:|:
Human   240 GNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTAL 304

  Fly   579 LPGKPLSESGKQNEQLMATLEC-----AD-IQCLREASSERL--WAATPDTWLHFPVDLPQPQEA 635
            .......:..|....|...:.|     .| ::|||..:.:.|  ...||.|: |.          
Human   305 SSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATY-HI---------- 358

  Fly   636 NASGSRHEWLVLDGDVVFEHP 656
             |.|.     |:||||:.:.|
Human   359 -AFGP-----VIDGDVIPDDP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 99/346 (29%)
NLGN4XXP_005274621.1 COesterase 42..610 CDD:278561 99/346 (29%)
Aes <179..>286 CDD:223730 45/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.