DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and ces2b

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:XP_021326380.1 Gene:ces2b / 561967 ZFINID:ZDB-GENE-041014-96 Length:1611 Species:Danio rerio


Alignment Length:550 Identity:142/550 - (25%)
Similarity:206/550 - (37%) Gaps:170/550 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 TGCGPVEGV------KEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCT 423
            |..|.::|:      |:....::.|||:|||||..||..|.:..:.    |..........::|.
Zfish    33 TNSGALKGLQMKARGKDTVIHSYLGIPFAKPPVGPLRLAPPQPAEK----WEGVRDATKQPLMCL 93

  Fly   424 Q----------RLGNGTTVGD--EDCLYLDVVTP-HVRYNNPLPVVVLIGAESLAGPSPGILRPS 475
            |          .|.....:.|  ||||||:|.|| ....|:.|||:|.|       ...|....|
Zfish    94 QDRQLVEDLVANLSAKVDMVDSSEDCLYLNVYTPSKPGRNDKLPVMVWI-------HGGGFTTCS 151

  Fly   476 ARYSRSH------DVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVH 534
            |.....|      ||:.|...:|||:.||.:    |.:.:.|  |||.|.|.:|.|.|::.||..
Zfish   152 ASLFDGHVLAAYQDVVVVVIQYRLGLLGFFS----TGDENAP--GNYGLLDQVAALQWVQENIHS 210

  Fly   535 FGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGS----AILPGKPL-------SESG 588
            |||||.|||:.|..||...|:|.|.|.....|:.||.|.||:    ||:...||       :.||
Zfish   211 FGGDPGSVTIFGESAGGISVSLHVLSPLSANLFHRAIAESGTAAMEAIMNVNPLPIAQAIGNASG 275

  Fly   589 KQNEQLMATLECADIQCLREASSERLWAATPDTWL-HFPVDLPQPQEANASGSRHEWLVLDGDVV 652
            .   .:.:|.:..|  ||.:.|...:...|.:..| .|.|                  .:||..:
Zfish   276 C---DISSTKKIVD--CLMQKSEVEILKITMENPLFRFGV------------------TIDGQFL 317

  Fly   653 FEHPSDTWKREQANDKPVLVMGATAHEAHTEKLRELHANWTREEVRAYLENSQIGALGLTDEVIE 717
            ....::.::.:|.|..|::.                                     |:||:.| 
Zfish   318 PRPAAELFQSQQFNKVPLMT-------------------------------------GVTDDEI- 344

  Fly   718 KYNASSYASLVSIIS--DIRSVCPLLT---NARQQPSVPFYVVTQ--GEGPD------------- 762
            .:...:|......|:  |:.|:.||||   .|.|..||...::.:  |..||             
Zfish   345 GFVLPNYLLPPDWINGLDLESILPLLTVFNPALQDQSVLELLLNEYLGTSPDRIRIRDGFREMLG 409

  Fly   763 ---------QLATVDADVQAILGRYE---PHTVEQRRFVS--------AMQQLFYYYVSHGTVQS 807
                     |.|:...|..|.:..||   |.:|.||:..|        .:..:|.|..|.|.   
Zfish   410 DFMFNIPARQTASYHRDAGAPVYVYEFRHPPSVLQRKRPSFSGSDHGDEIVFVFGYCFSEGP--- 471

  Fly   808 FVQNRRVINVGQDAQPEEDYLPCN----YW 833
                   |.:.::...|||.| |.    ||
Zfish   472 -------IGMAENLSDEEDEL-CRTTMAYW 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 140/547 (26%)
ces2bXP_021326380.1 COesterase 27..539 CDD:306613 141/549 (26%)
COesterase 553..1065 CDD:306613
COesterase 1079..1592 CDD:306613
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.