DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and nlgn4xa

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:XP_021330915.1 Gene:nlgn4xa / 561122 ZFINID:ZDB-GENE-100309-2 Length:844 Species:Danio rerio


Alignment Length:456 Identity:111/456 - (24%)
Similarity:165/456 - (36%) Gaps:136/456 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 GPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQRLGNGTTV 432
            ||||        .:.|||||.||....|::|.|    ..|.|.........:.||.|.|.:...:
Zfish    65 GPVE--------QYLGIPYALPPTGERRFQPPE----PPMSWPGIRNATQFAPVCPQFLEDRFLL 117

  Fly   433 GD---------------------EDCLYLDVVTP---------------------HVRYNNPL-P 454
            .|                     ||||||::..|                     .:...|.| |
Zfish   118 NDMLPVWFTANLDTVVTYVQDQSEDCLYLNIYVPTEDVGANKGDDFTNNEGGENKDIHDENGLRP 182

  Fly   455 VVVLIGAESLAGPSPGILRPS--ARYSRSHDVIFVRPNFRLGVFGFLAL-DALTKEAHPPTSGNY 516
            |:|.|...|....:..::..|  |.|.   :||.|..|:||||.|||:. |...|       |||
Zfish   183 VMVYIHGGSYMEGTGNMIDGSILASYG---NVIVVTLNYRLGVLGFLSTGDQAAK-------GNY 237

  Fly   517 ALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPG 581
            .|.|.|..|.|||.||..|.|||:.||:.|..|||:.|:||..|...:.|:.:|...||:|:...
Zfish   238 GLLDQIQALRWIKENIQAFKGDPKRVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSW 302

  Fly   582 KPLSESGKQNEQLMATLEC-----AD-IQCLREASSERLWAATPDTWLHFPVDLPQPQEANASGS 640
            ....:..|....|...:.|     .| ::||:..:.:.|          ....:.|.:...|.|.
Zfish   303 AVNYQPAKYTRILAEKVGCNMLDSIDLVECLQNKNYKEL----------IEQYITQAKYHIAFGP 357

  Fly   641 RHEWLVLDGDVVFEHPS------------------------------DTWKREQANDKPVLVMGA 675
                 |:||||:.:.|.                              |:.....|||....|...
Zfish   358 -----VIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGFKFVDGIVDSEDGVSANDFDFAVSDF 417

  Fly   676 TAH--------EAHTEKLRELHANWTREE---------VRAYLENSQIGALGLTDEVIEKYNASS 723
            ..|        :...|.::.::.:|..:|         |..:.::..:.....|.::..:|.:.:
Zfish   418 VDHLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPT 482

  Fly   724 Y 724
            |
Zfish   483 Y 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 111/456 (24%)
nlgn4xaXP_021330915.1 COesterase 43..605 CDD:306613 111/456 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.