DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and NLGN3

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_851820.1 Gene:NLGN3 / 54413 HGNCID:14289 Length:848 Species:Homo sapiens


Alignment Length:408 Identity:106/408 - (25%)
Similarity:149/408 - (36%) Gaps:131/408 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 LLLGVIGYVLTHETLTSPP--------LREGRYIMAVTGCGPVEGVKEDGAFAFRGIPYAKPPVD 392
            |.|..:...|...|....|        ||..|..:.....|||:        .:.|:|||.||:.
Human    24 LTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVD--------QYLGVPYAAPPIG 80

  Fly   393 RLRWKPAELIDDINMCWNDTLQTHNSSVVCTQRL--------------GNGTTVG------DEDC 437
            ..|:.|.|....    |:......:...||.|.:              .|...|.      :|||
Human    81 EKRFLPPEPPPS----WSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDC 141

  Fly   438 LYLDVVTP-------------------------------------------HVRYNNPLPVVVLI 459
            |||:|..|                                           .:|.:...||:|.|
Human   142 LYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYI 206

  Fly   460 GAESLAGPSPGILRPS--ARYSRSHDVIFVRPNFRLGVFGFLAL-DALTKEAHPPTSGNYALTDI 521
            ...|....:..::..|  |.|.   :||.:..|:|:||.|||:. |...|       |||.|.|.
Human   207 HGGSYMEGTGNMIDGSILASYG---NVIVITLNYRVGVLGFLSTGDQAAK-------GNYGLLDQ 261

  Fly   522 IAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSE 586
            |..|.|:..||..|||||:.:|:.|...||:.|:||..|...:||:.||...||||:       .
Human   262 IQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSAL-------S 319

  Fly   587 SGKQNEQ------LMA------TLECAD-IQCLREASSERLWAATPDTWLHFPVDLPQPQEANAS 638
            |...|.|      |:|      .|:..| :.|||:.|::.|          ...|:...:...|.
Human   320 SWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKEL----------VEQDIQPARYHVAF 374

  Fly   639 GSRHEWLVLDGDVVFEHP 656
            |.     |:||||:.:.|
Human   375 GP-----VIDGDVIPDDP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 98/374 (26%)
NLGN3NP_851820.1 COesterase 36..624 CDD:278561 103/396 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..195 0/24 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.