DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and Ces2h

DIOPT Version :10

Sequence 1:NP_476798.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001258974.1 Gene:Ces2h / 436059 MGIID:3648740 Length:558 Species:Mus musculus


Alignment Length:219 Identity:48/219 - (21%)
Similarity:70/219 - (31%) Gaps:64/219 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGDLGLATVMEQANAKSVIG-TPEFMAPELYDENYNELADIYSFGMCMLEMVTFEYPYCECRNSA 109
            :|:..|....:..|.:..:. ||   .|.||.:|:.:| .::.|....|.......|.|      
Mouse    45 LGNTNLFKTQKHLNVERKVNITP---IPVLYKKNFTKL-PVWDFEDVYLRDSNARKPTC------ 99

  Fly   110 QIYKKVSSGIKPASLSKVKDPE----VMKFIEKCLLPASERLSAEELLLDSFLNVNGLVMNN--- 167
                       |.||...:|||    |:..|:..|......:| |...|..|.|..|.:..|   
Mouse   100 -----------PKSLHNTEDPEFKESVLPDIQLWLYKGQLNMS-EWNRLAHFNNPFGFMEYNYNE 152

  Fly   168 --------PLPLPDIVMP-----KEGSFGERCLMSEGPPNARNRTMSMNLDEDNNLPIVISSNNS 219
                    |.|...|::|     |:|..  ||.:........|..|...:|..:.:         
Mouse   153 IKRAVDLIPKPRSSILLPVPKGSKDGCI--RCAVVGAGGILNNSKMGREIDSHDYV--------- 206

  Fly   220 GTNCIEVRRAKRGNFFVLKGEEND 243
                      .|.|..|.||.|.|
Mouse   207 ----------FRVNGAVTKGYEED 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_476798.1 PTZ00121 <3..>222 CDD:173412 41/196 (21%)
alpha/beta hydrolases 362..832 CDD:473884
Ces2hNP_001258974.1 COesterase 30..537 CDD:395084 48/219 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.