DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and alpha-Est3

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001163540.1 Gene:alpha-Est3 / 40907 FlyBaseID:FBgn0015571 Length:543 Species:Drosophila melanogaster


Alignment Length:357 Identity:97/357 - (27%)
Similarity:140/357 - (39%) Gaps:89/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 TGCGPV-----EGVKEDGAFAFRGIPYAKPPVDRLRWK---PAELIDDINMCWNDTLQTHNSSVV 421
            |..|||     .||..|...:|..||||:|||..||:.   |.|       .|:..|.       
  Fly     8 TTSGPVLGKQCTGVYGDEYVSFERIPYAQPPVGHLRFMAPLPVE-------PWSQPLD------- 58

  Fly   422 CTQ--------RLGNGTTVGDEDCLYLDVVTPHVRYNNPLPVVVLI--GAESLAGPSPGILRPSA 476
            ||:        ...:....|.||||||:|....:....|||::|..  |......|:..:..|. 
  Fly    59 CTKPGQKPLQFNHYSKQLEGVEDCLYLNVYAKELDSPRPLPLIVFFFGGGFEKGDPTKELHSPD- 122

  Fly   477 RYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQS 541
             |....||:.|..::|:|..|||:|:    :......||..|.|.:..:.|||.|...|.|||::
  Fly   123 -YFMMRDVVVVTVSYRVGPLGFLSLN----DPAVGVPGNAGLKDQLLAMEWIKENAERFNGDPKN 182

  Fly   542 VTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAI----------LPGKPLSESGKQNEQLMA 596
            ||..|..|||..|..|:.:.|.:||:.:|...||:.:          ||.:.....|.::.:.:.
  Fly   183 VTAFGESAGAASVHYLMLNPKAEGLFHKAILQSGNVLCSWALCTIKNLPHRLAVNLGMESAEHVT 247

  Fly   597 TLECADIQCLREASSERLWAATPDTWLHFPVDLPQPQEANASGSRHEWLVLDGDVVFE------- 654
            .....|.  |::...|:|..         |..|        |...|    || |.||:       
  Fly   248 DAMVLDF--LQKLPGEKLVR---------PYLL--------SAEEH----LD-DCVFQFGPMVEP 288

  Fly   655 ----------HPSDTWKREQANDKPVLVMGAT 676
                      ||.:...:...|..|||:.|.:
  Fly   289 YKTEHCALPNHPQELLDKAWGNRIPVLMSGTS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 97/357 (27%)
alpha-Est3NP_001163540.1 Abhydrolase 3..529 CDD:304388 97/357 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.