DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and alpha-Est6

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_524262.1 Gene:alpha-Est6 / 40902 FlyBaseID:FBgn0015574 Length:568 Species:Drosophila melanogaster


Alignment Length:260 Identity:84/260 - (32%)
Similarity:125/260 - (48%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 VEGVKEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQR-LGNGTTVG 433
            :.|:..|..::|.|||:||||:.:.|:..::|.|.    ||..|.......:..|. ..:|..||
  Fly    55 LSGIYGDEFYSFEGIPFAKPPLGKARFVASQLADP----WNSELDARQERPIPLQMDRRSGKVVG 115

  Fly   434 DEDCLYLDVVTPHVRYNN-PLPVVVLI--GAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGV 495
            .||||||:|.|.|...:. ||||:|.|  ||....|.......|.  |..|.||::|..|:||..
  Fly   116 SEDCLYLNVYTKHFNESEPPLPVMVYIYGGAFRTGGAVKSKYGPD--YLMSRDVVYVLFNYRLCS 178

  Fly   496 FGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNS 560
            .|||::.:    ......||..|.|.:..|.|:..:|.:|.||||::||.|..|||..|..::..
  Fly   179 LGFLSMPS----GKLDVPGNAGLHDQLLALQWVSQHIRNFNGDPQNITLFGESAGAASVHFMMCL 239

  Fly   561 QKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATL-----------ECADIQCLREASSERL 614
            .:.|||:.:|...|||.:.|.....:|    :.:...|           |...::.||..::|:|
  Fly   240 PQAKGLFHKAIMMSGSMLSPWVNAPDS----DGIFCRLATSAGYEGPAEEVPILEFLRNVNAEKL 300

  Fly   615  614
              Fly   301  300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 84/260 (32%)
alpha-Est6NP_524262.1 COesterase 35..534 CDD:278561 84/260 (32%)
Aes <133..325 CDD:223730 55/178 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.