DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and alpha-Est8

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_524259.2 Gene:alpha-Est8 / 40899 FlyBaseID:FBgn0015576 Length:574 Species:Drosophila melanogaster


Alignment Length:375 Identity:106/375 - (28%)
Similarity:151/375 - (40%) Gaps:91/375 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 LREGRYIMAVTGCGPVEGVK-----EDGAFAFRGIPYAKPPVDRLRWK---PAELIDDINMCWND 411
            ||....::|.|..|.|:|||     .:..::|.|||:|||||..||:|   ..|...|:..|   
  Fly    27 LRSNDKVIADTVYGKVKGVKWQSIYGNNYYSFEGIPFAKPPVGELRFKAPVEPEHWSDVKRC--- 88

  Fly   412 TLQTHNSSVVCTQRLGNGTTVGDEDCLYLDVVTPHVRYNNPLPVVVLI--GAESLAGPSPGILRP 474
               ||..:..|...:......|.||||||:|.|..:..:.||||:|.|  |...:...|..:..|
  Fly    89 ---THVRAKPCQVNIVLKQVQGSEDCLYLNVYTRELHPHRPLPVLVWIYGGGFQMGEASRDLYSP 150

  Fly   475 SARYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDP 539
            .  |.....|:.|..::|||..|||:|  ..:|...|  ||..|.|.:..|.|:|.|...|||||
  Fly   151 D--YIMMEHVVLVVISYRLGALGFLSL--ADEELDVP--GNAGLKDQVMALRWVKRNCQFFGGDP 209

  Fly   540 QSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADIQ 604
            .::|:.|..||......::.:.:.|||:.:....||||:.|                        
  Fly   210 DNITVFGESAGGASTHYMMLTDQAKGLFHKTIIMSGSALAP------------------------ 250

  Fly   605 CLREASSERLWAATPDTWLHFPVDLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWKREQANDKP 669
                      ||.|| |.:::|..|     |.|:|       ..||              |||:.
  Fly   251 ----------WAQTP-THINWPYRL-----AQATG-------YTGD--------------ANDRD 278

  Fly   670 VLVMGATAHEAHTEKLRELHANWTREEVRAYLENSQIGALGLTDEVIEKY 719
            :.        ||.:|.:........|::....|..|...:......||.|
  Fly   279 IF--------AHLKKCKASSMLKVAEDIITMEERHQRLTMFSFGPTIEPY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 104/368 (28%)
alpha-Est8NP_524259.2 COesterase 29..564 CDD:278561 104/373 (28%)
Aes <116..>221 CDD:223730 39/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.