DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and gas

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster


Alignment Length:469 Identity:122/469 - (26%)
Similarity:194/469 - (41%) Gaps:84/469 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 LLLG--VIGYVLTHETLTSPPLREGRYIMAVTGCGPVEGVKE----DGA--FAFRGIPYAKPPVD 392
            |.||  :||:.:....|.:...:|     ..|..|.::|.:.    ||.  ::|.|||:|:|||.
  Fly    11 LKLGAKIIGHKVVQYKLGTGQTKE-----LATKYGQLKGQQRRTLYDGEPYYSFEGIPFAQPPVG 70

  Fly   393 RLRWK---PAELIDDINMCWNDTLQTHNSSVVCTQRLGNGTTVGDEDCLYLDVVTPHVRYNNPLP 454
            .||::   |......:..|      |:.......:........|.||||||:|....:....|||
  Fly    71 ELRFRAPQPPSSWQGVRDC------TYAREKPMQRNSITNAAEGSEDCLYLNVYAKRLESPKPLP 129

  Fly   455 VVVLI--GAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYA 517
            |:|.|  |...:.|.|..:..|.  |...||::.|..|:|:||.|||:|.  .||...|  ||..
  Fly   130 VMVWIFGGGFQVGGASRELYGPD--YFMKHDILLVTINYRVGVLGFLSLK--DKELKIP--GNAG 188

  Fly   518 LTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILP-- 580
            |.|.|..|.|:|.||..|.|||:|:|:.|..||.....:|:.:::.:||:.||...||||:..  
  Fly   189 LKDQIQALRWVKENIASFNGDPESITVFGESAGGASTHILMQTEQARGLFHRAIVQSGSALCAWA 253

  Fly   581 -----------GKPLSESG--KQNEQLMATLE----------CADIQCLREASSERLWAATP--D 620
                       ||.|..:|  :..::|:...:          |..|....|.....:.|..|  :
  Fly   254 TQPDRKWPQRLGKELGYAGNLESEKELLEFFQQIPASKLAQYCNSIVTQEEQRDYEILAFAPVIE 318

  Fly   621 TWLHFPVDLPQPQEANASGSRHEW----LVLDGDVVFEHPSDTWKREQANDKPVLVMGATAHEAH 681
            .::.....:|:.|:...|.:   |    .::.|...||   ..:......|.|:.::  :|.||.
  Fly   319 PYVGDDCVIPKSQQEQLSSA---WGNSIPMIIGGTSFE---GLFSYRTTLDDPLYML--SAFEAI 375

  Fly   682 TEKL------RELHANWTREEVRAYLENSQIGALGLTDEVIEKYNASSYASLVSIISDIRSVCPL 740
            ..|.      :|..|...|...::|.::....::       |.|......|:.:...||...  |
  Fly   376 IPKQVRDAIDKEELAEMVRRLKKSYFDDPDRASM-------ELYECLHILSIKNFWHDIHRT--L 431

  Fly   741 LTNARQQPSVPFYV 754
            |.......::|.|:
  Fly   432 LARLAYATNLPTYL 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 115/441 (26%)
gasNP_611678.1 COesterase 28..534 CDD:278561 116/452 (26%)
Aes <117..>222 CDD:223730 44/110 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.