DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and CG5397

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001259865.1 Gene:CG5397 / 33313 FlyBaseID:FBgn0031327 Length:665 Species:Drosophila melanogaster


Alignment Length:530 Identity:128/530 - (24%)
Similarity:188/530 - (35%) Gaps:152/530 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 VEGVK--EDGAFAFRGIPYAKPPVDRLRW-KPA--ELIDDINM------CWNDTLQTHNSSVVCT 423
            |||.:  ..|.::|.|:.||:|||..||: :|.  .|..|.|.      |    :|.|..   ..
  Fly    63 VEGFRNPSTGIYSFLGMHYAEPPVGPLRYSRPVYKRLAGDFNATKHGPPC----IQPHPQ---FP 120

  Fly   424 QRLGNGTTVGDEDCLYLDVVTPHV-RYNNPLPVVVLIGAESLAGPSPGILR--PSARYSRS---- 481
            ||:     :||||||.|:|.||.: .....|||.|.|        .||..|  .:|:|..:    
  Fly   121 QRI-----IGDEDCLLLNVYTPQMPDETTGLPVFVWI--------HPGGYRYGSAAQYDATPMAQ 172

  Fly   482 HDVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLG 546
            ...|.|.|.:|||..|.:. |. ||:    ..||.|:.|:.|.|.|:...|.:|||:|:.|..:|
  Fly   173 RGAIVVAPQYRLGSLGIMG-DG-TKQ----FDGNLAMFDLAAALRWVTDYISYFGGNPKQVQAIG 231

  Fly   547 HRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADI-------- 603
            |.:||.....|..|...:.    |....|...:.|..||:.....|.:.:..|.|.|        
  Fly   232 HGSGAASAMYLSMSPTSRS----AGDVHGVVAMSGTALSQYAMDKEPVQSVQEVAKINGCPTGNE 292

  Fly   604 ----QCLREASSERLWAATPDTWLHFPVDLPQPQEANASGSRHEWLV--LDGDVVFE-------- 654
                .|||..|:|.:              :....:..........||  |.|:|.|:        
  Fly   293 LEIVNCLRSKSAEDI--------------IKNDDKVQTERLAGRALVKGLTGNVGFQPHIESEDD 343

  Fly   655 ----------HPSDTWKREQANDKPVLVMGATAHEAHTEKLRELHANWTREEVRAYLENSQIGAL 709
                      .|....|....:..|:|. |.|.||.                           |.
  Fly   344 GRALPSLIVGEPEQQLKSSNFSGIPLLT-GVTKHET---------------------------AN 380

  Fly   710 GLTDEVIEKYNASSYASLVSIISDIRSVCPL-----LTNARQQPSVP------------FYVVTQ 757
            .:|.|.|||...|:...|.|:...:..:...     ||....:|.:|            .:.|.|
  Fly   381 SVTVETIEKVFGSAEQFLGSLSDSLNKLTSFLKIDKLTGQIAKPELPGLTSVLTPTLQDVWKVPQ 445

  Fly   758 GEGPDQL------ATVDA--DVQAILGRYEPHTVEQRRFVSAMQQLFYYYVSHGTVQSFVQNRRV 814
            ....||:      :|.|.  ::.|:|     .|....|...|....|.|..:.....:|::...:
  Fly   446 ALNVDQVLSKVVESTTDVLFNLPAVL-----TTQVWSRLAPAFMYSFEYNGTKSKGINFLKGLPI 505

  Fly   815 INVGQDAQPE 824
            ::.....:||
  Fly   506 VSETAHDKPE 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 128/530 (24%)
CG5397NP_001259865.1 COesterase 62..600 CDD:278561 128/530 (24%)
Aes 82..>261 CDD:223730 66/208 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11559
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.