DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and Nlgn3

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_766520.2 Gene:Nlgn3 / 245537 MGIID:2444609 Length:825 Species:Mus musculus


Alignment Length:388 Identity:108/388 - (27%)
Similarity:151/388 - (38%) Gaps:111/388 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 LLLGVIGYVLTHETLTSPP--------LREGRYIMAVTGCGPVEGVKEDGAFAFRGIPYAKPPVD 392
            |.||.:..||...|....|        ||..|..:.....|||:        .:.|:|||.||:.
Mouse    21 LTLGFLSLVLRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVD--------QYLGVPYAAPPIG 77

  Fly   393 RLRWKPAELIDDINMCWNDTLQTHNSSVVCTQRL--------------GNGTTVG------DEDC 437
            ..|:.|.|....    |:......:...||.|.:              .|...|.      :|||
Mouse    78 EKRFLPPEPPPS----WSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDC 138

  Fly   438 LYLDVVTP-----------------------HVRYNNPLPVVVLIGAESLAGPSPGILRPS--AR 477
            |||:|..|                       .:|.:...||:|.|...|....:..::..|  |.
Mouse   139 LYLNVYVPTEDGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLAS 203

  Fly   478 YSRSHDVIFVRPNFRLGVFGFLAL-DALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQS 541
            |.   :||.:..|:|:||.|||:. |...|       |||.|.|.|..|.|:..||..|||||:.
Mouse   204 YG---NVIVITLNYRVGVLGFLSTGDQAAK-------GNYGLLDQIQALRWVSENIAFFGGDPRR 258

  Fly   542 VTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQ------LMA---- 596
            :|:.|...||:.|:||..|...:||:.||...||||:       .|...|.|      |:|    
Mouse   259 ITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSAL-------SSWAVNYQPVKYTSLLADKVG 316

  Fly   597 --TLECAD-IQCLREASSERLWAATPDTWLHFPVDLPQPQEANASGSRHEWLVLDGDVVFEHP 656
              .|:..| :.|||:.|::.|          ...|:...:...|.|.     |:||||:.:.|
Mouse   317 CNVLDTVDMVDCLRQKSAKEL----------VEQDIQPARYHVAFGP-----VIDGDVIPDDP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 98/354 (28%)
Nlgn3NP_766520.2 COesterase 39..601 CDD:365897 102/370 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..172 0/20 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.