DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and NLGN1

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001352852.1 Gene:NLGN1 / 22871 HGNCID:14291 Length:843 Species:Homo sapiens


Alignment Length:411 Identity:114/411 - (27%)
Similarity:162/411 - (39%) Gaps:114/411 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 CSVDDALIVFGILLFVLLLGVI---GYVLTHETLTSPPLREGRYIMAVTGCGPVEGVKED----- 376
            |.|...|   |..|.:.:||.:   |:||:.:.....||       ..|..|.:.|:|::     
Human    19 CLVHRGL---GAPLTLCMLGCLLQAGHVLSQKLDDVDPL-------VATNFGKIRGIKKELNNEI 73

  Fly   377 --GAFAFRGIPYAKPPVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQRLGNG---------- 429
              ....|.|:|||.||....|::|.|....    |:|.......:.||.|.:.:|          
Human    74 LGPVIQFLGVPYAAPPTGERRFQPPEPPSP----WSDIRNATQFAPVCPQNIIDGRLPEVMLPVW 134

  Fly   430 ---------TTVGD--EDCLYLDVVTP-----------------------HVR-YNNPLPVVVLI 459
                     :.|.|  ||||||::..|                       .:| ...|.||:|.|
Human   135 FTNNLDVVSSYVQDQSEDCLYLNIYVPTEDGPLTKKQTDDLGDNDGAEDEDIRDSGGPKPVMVYI 199

  Fly   460 -GAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLAL-DALTKEAHPPTSGNYALTDII 522
             |...:.|  .|.|...:..:...:||.:..|:||||.|||:. |...|       |||.|.|:|
Human   200 HGGSYMEG--TGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQAAK-------GNYGLLDLI 255

  Fly   523 AVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVN---------SQKVKGLYTRAWASSGSAI 578
            ..|.|...||..|||||..:|:.|..||.:.|.||..         |...|||:.||.|.||:|:
Human   256 QALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTAL 320

  Fly   579 LPGKPLSESGKQNEQLMATLEC--AD----IQCLREASSERLWAATPDTWLHFPVDLP-QPQEAN 636
            .......:..|....|...:.|  :|    ::||::...:.|            ||.. ||...:
Human   321 SSWAVSFQPAKYARMLATKVGCNVSDTVELVECLQKKPYKEL------------VDQDIQPARYH 373

  Fly   637 -ASGSRHEWLVLDGDVVFEHP 656
             |.|.     |:||||:.:.|
Human   374 IAFGP-----VIDGDVIPDDP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 102/366 (28%)
NLGN1NP_001352852.1 COesterase 53..626 CDD:365897 104/374 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.