DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and cest-6

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_501070.1 Gene:cest-6 / 177459 WormBaseID:WBGene00020688 Length:583 Species:Caenorhabditis elegans


Alignment Length:253 Identity:70/253 - (27%)
Similarity:104/253 - (41%) Gaps:51/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 FGILLFVLLLGVIGY------VLTHETLTSPPLREGRYIMAVTGCGPVEGVKEDGAFAFRGIPYA 387
            |.:|:||||:....|      |:|                  |..|.:.|.:......|:.||:|
 Worm     4 FDMLIFVLLIVYSAYKSCEAGVIT------------------TSLGSINGNQIGSYQTFKKIPFA 50

  Fly   388 KPPVDRLRW-KP--AELIDDINMCWNDTLQTHNSSVVCTQRLGNGTTVG------DEDCLYLDVV 443
            |||:.:||: ||  ||.       |...|........|   :.|.:|..      |||||::::.
 Worm    51 KPPIGKLRFQKPMAAEK-------WEGILNATEYGPAC---MSNSSTSKSPQKWIDEDCLHINIF 105

  Fly   444 TPHVRYNNP-LPVVVLIGAESLAGPSPGILRPSARYS--RSHDVIFVRPNFRLGVFGFLALDALT 505
            |.....::. ..||..:....|...|..:......:.  .|.|||.|.|.||||:|....:    
 Worm   106 TTDTCLSSKNCSVVFYVHGGELVYDSAVMFEDKYLFDTFSSRDVILVIPAFRLGLFSHFVV---- 166

  Fly   506 KEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKV 563
             |.......|.||.||:..|.::|..|.:|||....||..||..|..:|:::..|.::
 Worm   167 -EDQNVAPNNLALYDILLALEFVKSEIHNFGGSSDRVTAFGHSYGGHVVSVMAFSTEI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 61/214 (29%)
cest-6NP_501070.1 Abhydrolase 25..500 CDD:389770 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.