DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and CEL

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001798.3 Gene:CEL / 1056 HGNCID:1848 Length:753 Species:Homo sapiens


Alignment Length:555 Identity:141/555 - (25%)
Similarity:202/555 - (36%) Gaps:179/555 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 GPVEGVKE------DGAFAFRGIPYAKP--PVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQ 424
            |.||||.:      |....|:|||:|.|  .::..:..|.         |..||:..|....|.|
Human    31 GFVEGVNKKLGLLGDSVDIFKGIPFAAPTKALENPQPHPG---------WQGTLKAKNFKKRCLQ 86

  Fly   425 -RLGNGTTVGDEDCLYLDVVTPHVR--YNNPLPVVVLI-GAESLAGPSPG------ILRPSARYS 479
             .:...:|.||||||||::..|..|  .:..|||::.| |...|.|...|      .|......:
Human    87 ATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIA 151

  Fly   480 RSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTL 544
            ...:||.|..|:|:|..|||:    |.:|:.|  |||.|.|....:.|:|.||..|||||.::||
Human   152 TRGNVIVVTFNYRVGPLGFLS----TGDANLP--GNYGLRDQHMAIAWVKRNIAAFGGDPNNITL 210

  Fly   545 LGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILP----GKPLSESGKQNEQLMATLECAD--I 603
            .|..||...|:|...|...|||..||.:.||.|:.|    ..||..:.|..|::...:..|.  .
Human   211 FGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMA 275

  Fly   604 QCLREASSERLWAA--TPDTWLHFPV-----DLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWK 661
            |||:......|..|  .|...|.:|:     .:|               |:|||.:...|.:.: 
Human   276 QCLKVTDPRALTLAYKVPLAGLEYPMLHYVGFVP---------------VIDGDFIPADPINLY- 324

  Fly   662 REQAN---------------------DKPVLVMG-------------------------ATAHEA 680
               ||                     |.|.:..|                         .|..:.
Human   325 ---ANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDV 386

  Fly   681 HTEKLRELHANWTREEVRAYLENSQIGALGLTDEVI-----------EKYNASS---YASLVSII 731
            :||       :|.::..:   ||.:...:....:|:           .:.||.|   ||.|.|  
Human   387 YTE-------SWAQDPSQ---ENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFS-- 439

  Fly   732 SDIRSVCPLLTNARQQPSVPFYVVTQGEGPDQLATVDADVQAILGR-------YEPHTVEQRRFV 789
                       :..:.|..|.:|     |.|..    .|:|.:.|:       |.|    |.|.|
Human   440 -----------HPSRMPVYPKWV-----GADHA----DDIQYVFGKPFATPTGYRP----QDRTV 480

  Fly   790 S-AMQQLFYYYVSHGTVQSFVQNRRVINVGQDAQP 823
            | ||...:..:...|..          |:|..|.|
Human   481 SKAMIAYWTNFAKTGDP----------NMGDSAVP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 141/555 (25%)
CELNP_001798.3 Heparin-binding 21..121 32/98 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..753
17 X 11 AA tandem repeats, glycodomain, O-linked (mucin type) 559..745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.