DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrt and Ces1f

DIOPT Version :9

Sequence 1:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001096829.2 Gene:Ces1f / 100125372 RGDID:1642419 Length:561 Species:Rattus norvegicus


Alignment Length:512 Identity:136/512 - (26%)
Similarity:216/512 - (42%) Gaps:117/512 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 LLFVLLLGVIGYVLTHETLTSPPLRE-------GRYIMAVTGCGPVEGVKEDGAFAFRGIPYAKP 389
            |.|:.|:.:...|: :...:|||:.:       |:|:       .:|||.:..| .|.|:|:|||
  Rat     3 LSFLFLVSLATCVV-YGNPSSPPVVDTTKGKVLGKYV-------SLEGVTQSVA-VFLGVPFAKP 58

  Fly   390 PVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQRLGNGTTVGD--------------EDCLYL 440
            |:..||:.|.:..:.    |:....|.....:|:|....|..:.|              ||||||
  Rat    59 PLGSLRFAPPQPAEP----WSFVKNTTTYPPMCSQDAAKGQRMNDLLTNRKEKIHLEFSEDCLYL 119

  Fly   441 DVVTP-HVRYNNPLPVVVLI--GAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLALD 502
            ::.|| ....|:.|||:|.|  |..:|.|.|....|..:.|   .:|:.|...:|||::||.:  
  Rat   120 NIYTPADFTKNSRLPVMVWIHGGGMTLGGASTYDGRVLSAY---ENVVVVAIQYRLGIWGFFS-- 179

  Fly   503 ALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLY 567
              |.:.|  :.||:...|.:|.|:|::.||.:|||||.|||:.|..||...|::||.|...|.|:
  Rat   180 --TGDEH--SRGNWGHLDQVAALHWVQDNIANFGGDPGSVTIFGESAGGFSVSVLVLSPLTKNLF 240

  Fly   568 TRAWASSGSAILPG---KPLSESGKQNEQLM---ATLECADIQCLREASSERLWAATPDTWLHFP 626
            .||.:.||...|||   |.:..:.||...:.   .|.....:.|||:.:.|.|........|   
  Rat   241 HRAISESGVVFLPGLLTKDVRPAAKQIADMAGCETTTSAIIVHCLRQKTEEELLEIMKKMNL--- 302

  Fly   627 VDLPQPQEANASGSRHEWL--VLDGDVVFEHPSDTWKREQANDKPVLV--------------MGA 675
            :.|...::...|   :.:|  |:|..|:.:.|.:....:..|..|.:|              ||.
  Rat   303 IKLSSQRDNKES---YHFLSTVVDNVVLPKDPKEILAEKNFNTVPYIVGINKQECGWLLPTMMGF 364

  Fly   676 TAHEAHTEKLRELHANWTREEVRAYLENSQIGALGLTDEV----IEKYNASSYAS------LVSI 730
            ...:...:|...:    |..|..|.|       .|:.:::    ||||...|..|      :::.
  Rat   365 VPADVELDKKMAI----TLLEKFASL-------YGIPEDIIPVAIEKYRKGSDDSIKIRDGILAF 418

  Fly   731 ISDIRSVCPLLTNAR--------------------QQPSVPFYVVTQGEGPDQLATV 767
            |.|:....|.:..:|                    ..|..|.:||  |:..|.|.:|
  Rat   419 IGDVSFSIPSVMVSRDHRDAGAPTYMYEYQYYPSFSSPQRPKHVV--GDHADDLYSV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 127/475 (27%)
Ces1fNP_001096829.2 COesterase 24..545 CDD:278561 130/490 (27%)
Aes <121..>234 CDD:223730 45/121 (37%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 558..561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11559
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.