DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9701 and BGLU36

DIOPT Version :9

Sequence 1:NP_648918.1 Gene:CG9701 / 39872 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001319196.1 Gene:BGLU36 / 841574 AraportID:AT1G51490 Length:412 Species:Arabidopsis thaliana


Alignment Length:346 Identity:121/346 - (34%)
Similarity:187/346 - (54%) Gaps:54/346 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SCLGSP--VSQTRRFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPEKIVDRSNGDVSA 76
            ||: .|  :||     .:|.:|..:|:||:||   |..:..:.||:.||.:||::.|||.||::.
plant    17 SCI-QPKWISQ-----KNFTFGAATSAYQVEG---AAHRALNGWDYFTHRYPERVSDRSIGDLAC 72

  Fly    77 DSYHQWKRDVQMVKELHVGTYRFSLSWPRIMP-GGYMNHVSTAGIKYYSNLIDELLRYNITPMVT 140
            :||..:|.||:::|.::|..||||::|.|::| |..:..|...||.||:|||:||....|.|.||
plant    73 NSYDLYKDDVKLLKRMNVQAYRFSIAWSRVLPKGRLIGGVDENGITYYNNLINELKANGIEPFVT 137

  Fly   141 IYHWELPQKL-QELGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEPWHVCEHGYGVDYMAP 204
            |:||::||.. :.:.....|.... ||:||.|:.:.:|||||.|.|:|:|:.:...|||      
plant   138 IFHWDVPQDFRRRIWRLLKPTYSD-FKNYAELLFQRFGDRVKFWITLNQPYSLAVKGYG------ 195

  Fly   205 SYNYP-------------GIPAYLCGHNLLKAHAEVVHMYRELFQPRQGGRMGITLDTSWPEPRD 256
            ...||             |...|:.||:.|.||.|.|.:||:.:|..|||::|.||...|..|.:
plant   196 DGQYPPGRCTDCEFGGDSGTEPYIVGHHELLAHMEAVSLYRKRYQKFQGGKIGTTLIGRWFIPLN 260

  Fly   257 PNSAEDREASERAMQFYV-GWFGHPIFSKHGNYPKVMIERIRNLSKE-QGFGARSRLPEFTTEEI 319
            ..:..|:.|::|...|.| |..|                 :|.:||: :..|  .|||:||.::.
plant   261 ETNDLDKAAAKREFDFSVLGSTG-----------------VRTISKDNERLG--DRLPKFTPKQS 306

  Fly   320 HRIRGTSDFFGINSYTSNLVT 340
            ..::|:.||.|:|.|.:...|
plant   307 ALLKGSLDFLGLNYYVTRYAT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 117/336 (35%)
BGLU36NP_001319196.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2723
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63440
OrthoDB 1 1.010 - - D408001at2759
OrthoFinder 1 1.000 - - FOG0000180
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X89
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.