DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dbp73D and Ddx1

DIOPT Version :9

Sequence 1:NP_476833.1 Gene:Dbp73D / 39871 FlyBaseID:FBgn0004556 Length:687 Species:Drosophila melanogaster
Sequence 2:NP_524212.2 Gene:Ddx1 / 40457 FlyBaseID:FBgn0015075 Length:727 Species:Drosophila melanogaster


Alignment Length:353 Identity:93/353 - (26%)
Similarity:158/353 - (44%) Gaps:45/353 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 RALVVLPVAELALQVYRVISEL---CSKTELEVCLLSKQHKLEDEQEKLVEQYKGKYYSKADIVV 278
            :|:::.|..|||.|.|..|.:.   .|..|:...||....:||:::.:|::   |.:     |||
  Fly   288 QAIIMEPSRELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQ---GTH-----IVV 344

  Fly   279 TTPGRLVDHLHATKGFCLKS-LKFLVIDEADRIMDAVFQNWLYHLDSHV-KETTDQLLAGTQAPL 341
            .|||||.:.:::  |..|.: .:|.|:||||.::...:...:..|...: |.|:|.  ...|..:
  Fly   345 GTPGRLEEMINS--GLVLLTHCRFFVLDEADALLKQGYTELIDRLHKQIPKITSDG--RRLQMVV 405

  Fly   342 CYAELQA-SFGKQPHKLLFSAT----LSQD--PEKLQD-LRLFQPRLFAT--VLTMPVLKDATEE 396
            |.|.|.| ...|...:|:...|    ..:|  ||.:.. :.|..|::..|  .|..|:..|...:
  Fly   406 CSATLHAFEVKKMAERLMHFPTWVDLKGEDAVPETVHHVVCLVDPQMDTTWQSLRQPIGTDGVHD 470

  Fly   397 GADTEALTDPGQFVGRYTTPAE--LTEQYCVTELRLKPLTVFALVEKYKWKRFLCFTNSSDQATR 459
            ..:..    ||.......:.|.  |..:|||           ..::|:...|.:.|..:......
  Fly   471 RDNVH----PGNHSKETLSQAVKLLKGEYCV-----------HAIDKHNMDRAIIFCRTKQDCDN 520

  Fly   460 LTFVLKVLFQKYSTKVSELSGNLSAKVRNERLRDFAAGKINGLICSDALARGIDVADVDVVLSYE 524
            |...|:....|:.:.|. |.|:...:.|.|.|..|...::..|||:|..|||:|:..:..:::..
  Fly   521 LERFLRQRGGKHYSCVC-LHGDRKPQERKENLEMFKRQQVKFLICTDVAARGLDITGLPFMINVT 584

  Fly   525 TPRHITTYIHRVGRTARAGRKGTAVTVL 552
            .|...|.|:||:||..||.|.|.|::::
  Fly   585 LPDDKTNYVHRIGRVGRAERMGLAISLV 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dbp73DNP_476833.1 PRK11192 149..629 CDD:236877 93/353 (26%)
DEAD 162..370 CDD:278688 47/164 (29%)
HELICc 418..551 CDD:238034 37/134 (28%)
Ddx1NP_524212.2 P-loop_NTPase 4..>62 CDD:304359
SPRY_DDX1 91..242 CDD:293933
SrmB 279..>612 CDD:223587 93/351 (26%)
P-loop_NTPase <280..426 CDD:304359 43/149 (29%)
Helicase_C 492..602 CDD:278689 31/121 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.