DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dbp73D and ZK686.5

DIOPT Version :9

Sequence 1:NP_476833.1 Gene:Dbp73D / 39871 FlyBaseID:FBgn0004556 Length:687 Species:Drosophila melanogaster
Sequence 2:NP_001023030.2 Gene:ZK686.5 / 3565160 WormBaseID:WBGene00022795 Length:263 Species:Caenorhabditis elegans


Alignment Length:108 Identity:20/108 - (18%)
Similarity:39/108 - (36%) Gaps:21/108 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 ALAGL-----RSEKVKNKNQKMAEKNRVATKALIHKKQEETATVRPLTLMEKLQIKANEIVQSSK 651
            |:||:     .|....:.:..:|.|.|        |..:.|:|.:|.:..::.:....||....|
 Worm    78 AVAGIFVRSSTSSSFPSASSYIAAKKR--------KNVDNTSTRKPYSYKDRKRKNTEEIRNIKK 134

  Fly   652 K--------SSETKNSKTKADKTKYQPKETKKQIIAKQLKAIE 686
            |        .:.......|.|:.|...::..:.|:....:..|
 Worm   135 KLFMDLGIVRTNCGIDNEKQDREKAMKRKVTETIVTTYCELCE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dbp73DNP_476833.1 PRK11192 149..629 CDD:236877 9/41 (22%)
DEAD 162..370 CDD:278688
HELICc 418..551 CDD:238034
ZK686.5NP_001023030.2 C2H2 Zn finger 173..194 CDD:275368 1/5 (20%)
C2H2 Zn finger 201..221 CDD:275368
zf-C2H2_8 <204..251 CDD:292531
C2H2 Zn finger 232..248 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.