DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and pglyrp1-like.1

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001025626.1 Gene:pglyrp1-like.1 / 595014 XenbaseID:XB-GENE-5778936 Length:182 Species:Xenopus tropicalis


Alignment Length:180 Identity:75/180 - (41%)
Similarity:106/180 - (58%) Gaps:3/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVAALVLCCLALSANALQIEPRSSWGAVSARSPSRISGAVDYVIIHHSDNPNGCSTSEQCKRMIK 73
            |:.....|  ||:....:|..|||||.|.::..:::..:|.||||||:...: |::...||...:
 Frog     5 FIFLTAFC--ALAQGCPKIISRSSWGGVPSKCQAKLPRSVKYVIIHHTAGAS-CNSESACKAQAR 66

  Fly    74 NIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQM 138
            |||:.|.....:.|.||||::..||:||||||:...|:|:.|||..||||.|:|.|...||:...
 Frog    67 NIQNFHMKSNGWCDTGYNFLIGEDGQVYEGRGWETVGAHAKNYNFNSIGISFMGTFTNRAPNTAA 131

  Fly   139 LQNAKDLIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWR 188
            .:.|||||.....:..:..:|||.|||...||.|||..|||.||.||:::
 Frog   132 QKAAKDLISCGVAKKVINSDYTLKGHRDVSATECPGTNLYNLIKNWPNFK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 59/141 (42%)
pglyrp1-like.1NP_001025626.1 PGRP 19..160 CDD:128941 59/141 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.