DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and PGRP-LA

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster


Alignment Length:176 Identity:48/176 - (27%)
Similarity:77/176 - (43%) Gaps:23/176 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NALQIEPRSSWGA--------VSARSPSRISGAVDYVIIHH---SDNPNGCSTSEQCKRMIKNIQ 76
            |...:..|..|||        :..:.|      :.||:|.|   ...|  |....:|...::.||
  Fly   179 NGHLVVDREQWGASKNSHGLTIPLKRP------IPYVLITHIGVQSLP--CDNIYKCSIKMRTIQ 235

  Fly    77 SDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQMLQN 141
            ......:...||..||.|:.:|.:|.|||:    ..:..|..:::.|.|:|::.|..|..:.|:.
  Fly   236 DSAIAEKGLPDIQSNFYVSEEGNIYVGRGW----DWANTYANQTLAITFMGDYGRFKPGPKQLEG 296

  Fly   142 AKDLIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHW 187
            .:.|:..|.....:..:|.|....|||.|..||..:|.||:.|||:
  Fly   297 VQFLLAHAVANRNIDVDYKLVAQNQTKVTRSPGAYVYQEIRNWPHF 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 35/152 (23%)
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 35/152 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.