DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and PGRP-SD

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster


Alignment Length:186 Identity:70/186 - (37%)
Similarity:109/186 - (58%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LCCLALSANALQ----IEPRSSWGAVSARSPSRISGAVDYV-------IIHHSDNPNGCSTSEQC 68
            |..:.|:|.|:|    |..|:.|   :|:.|   :||:|.:       :|.|:.. ..|:....|
  Fly     6 LLIVGLTAIAVQGEVPIVTRAEW---NAKPP---NGAIDSMETPLPRAVIAHTAG-GACADDVTC 63

  Fly    69 KRMIKNIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSA 133
            .:.::|:|:....::.||||||::::.|:|||||||....:|:.:...|..|:||.||||||..|
  Fly    64 SQHMQNLQNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERA 128

  Fly   134 PSAQMLQNAKDLIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWRQ 189
            |:.:.|..||:|:|.|.::..|.:.|.|.||||..||..||:|||..|:.||:|.:
  Fly   129 PNKEALDAAKELLEQAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNWSE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 54/152 (36%)
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 53/148 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.