DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and PGRP-LD

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001137893.1 Gene:PGRP-LD / 3771920 FlyBaseID:FBgn0260458 Length:327 Species:Drosophila melanogaster


Alignment Length:196 Identity:52/196 - (26%)
Similarity:84/196 - (42%) Gaps:32/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VAALVLCCLALSANA---------------LQIEPRSSWGAVSARSPSRISG--AVDYVIIHHSD 57
            |..||:|..||:..|               |.|.....|..:..:....:..  .|..||..|:.
  Fly   139 VGLLVMCASALALAAYLLWRQTQTPDFGYRLSIVGHGIWSDMELQGRGTLFDPIGVGTVIFTHTG 203

  Fly    58 NPNGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPNYNR-KSI 121
            : |.|  .:.|..::..::..|.|     ::.|||:||||.:|:|.:|:..:..:..:.|. .|:
  Fly   204 S-NEC--HDDCPDVLHKLERSHVG-----ELPYNFLVAGDCQVFEAQGWHYRSQYPRDLNGIDSL 260

  Fly   122 GIVFIGNFERSAPSAQMLQNAKDLIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPH 186
            .:.|:|||....|....|..|:.||..:.:|..|:..|.||      ......|||..|::.|||
  Fly   261 VMAFVGNFSGRPPIDCQLMAAQALILESLKRRILQPIYQLF------VLGSYTDALQRELRHWPH 319

  Fly   187 W 187
            :
  Fly   320 Y 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 38/144 (26%)
PGRP-LDNP_001137893.1 PGRP 169..306 CDD:128941 38/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.